Web document 5.6. Alignment of vertebrate globins for input into HMMER.

 

>chicken_alpha_globin   gi|52138655|ref|NP_001004376.1| alpha 1 globin [Gallus gallus]

-MVLSAADKNNVKGIFTKIAGHAEEYGAETLERMFTTYPPTKTYFPHF------DLSHGS

AQIKGHGKKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIH

HPAALTPEVHASLDKFLCAVGTVLTAKYR------

>gi|6981010|ref|NP_037228.1|  hemoglobin alpha 1 chain [Rattus norvegicus]

-MVLSADDKTNIKNCWGKIGGHGGEYGEEALQRMFAAFPTTKTYFSHI------DVSPGS

AQVKAHGKKVADALAKAADHVEDLPGALSTLSDLHAHKLRVDPVNFKFLSHCLLVTLACH

HPGDFTPAMHASLDKFLASVSTVLTSKYR------

>mouse_alpha_globin     gi|6680175|ref|NP_032244.1| hemoglobin alpha 1 chain [Mus musculus]

-MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHF------DVSHGS

AQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASH

HPADFTPAVHASLDKFLASVSTVLTSKYR------

>human_alpha_globin     gi|4504347|ref|NP_000549.1| alpha 1 globin [Homo sapiens]

-MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF------DLSHGS

AQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAH

LPAEFTPAVHASLDKFLASVSTVLTSKYR------

>chicken_beta_globin    gi|71895591|ref|NP_001026660.1| hypothetical protein LOC428114 [Gallus gallus]

MVHWTAEEKQLITGLWGKV--NVAECGAEALARLLIVYPWTQRFFASFGNLSSATAIIGN

PMVRAHGKKVLSSFGEAVKNLDNIKKSFAQLSKLHCDKLHVDPENFRLLGDILIIVLASH

FSKDFTPASQAAWQKMVRVVAHALAHEYH------

>mouse_beta_globin      gi|17647499|ref|NP_058652.1| hemoglobin, beta adult minor chain [Mus musculus]

MVHLTDAEKSAVSCLWAKV--NPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGN

PKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHH

LGKDFTPAAQAAFQKVVAGVATALAHKYH------

>chimp_beta_globin      gi|55635219|ref|XP_508242.1| PREDICTED: hypothetical protein [Pan troglodytes]

MVHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGN

PKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHH

FGKEFTPPVQAAYQKVVAGVANALAHKYH------

>dog_beta_globin  gi|57113367|ref|XP_537902.1| PREDICTED: similar to beta globin [Canis familiaris]

MVHLTAEEKSLVSGLWGKV--NVDEVGGEALGRLLIVYPWTQRFFDSFGDLSTPDAVMSN

AKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHH

FGKEFTPQVQAAYQKVVAGVANALAHKYH------

>dog_beta_globin_isoform      gi|73988172|ref|XP_850823.1| PREDICTED: similar to beta globin isoform 1 [Canis familiaris]

MVHLTAEEKSLVSGLWGKV--NVDEVGGEALGRLLIVYPWTQRFFDSFGDLSTPDAVMSN

AKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHH

FGKEFTPQVQAAYQKVVAGVANALAHKYH------

>human_     beta_globin gi|4504349|ref|NP_000509.1| [Homo sapiens]

MVHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGN

PKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHH

FGKEFTPPVQAAYQKVVAGVANALAHKYH------

>chicken_myoglobin      gi|50728806|ref|XP_416292.1| PREDICTED: similar to Myoglobin [Gallus gallus]

-MGLSDQEWQQVLTIWGKVEADIAGHGHEVLMRLFHDHPETLDRFDKFKGLKTPDQMKGS

EDLKKHGATVLTQLGKILKQKGNHESELKPLAQTHATKHKIPVKYLEFISEVIIKVIAEK

HAADFGADSQAAMKKALELFRNDMASKYKEFGFQG

>chimp_myoglobin  gi|114686150|ref|XP_001156532.1| PREDICTED: similar to Myoglobin isoform 4 [Pan troglodytes]

-MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKAS

EDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLHSK

HPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

>dog_myoglobin    gi|73969214|ref|XP_850735.1| PREDICTED: similar to Myoglobin isoform 1 [Canis familiaris]

-MGLSDGEWQLVLNIWGKVETDLAGHGQEVLIRLFKNHPETLDKFDKFKHLKTEDEMKGS

EDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHATKHKIPVKYLEFISDAIIQVLQSK

HSGDFHADTEAAMKKALELFRNDIAAKYKELGFQG

>human_myoglobin  gi|4885477|ref|NP_005359.1| myoglobin [Homo sapiens]

-MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKAS

EDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSK

HPGDFGADAQGAMNKALELFRKDMASNYKELGFQG

>mouse_myoglobin  gi|21359820|ref|NP_038621.2| myoglobin [Mus musculus]

-MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGS

EDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKR

HSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG

>rat_myoglobin    gi|11024650|ref|NP_067599.1| myoglobin [Rattus norvegicus]

-MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSS

EDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKR

YSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG