Web document 5.8. Results of the hmmsearch program of HMMER using a set of vertebrate globins as a query (HMM file 01.hmm) and searching a database of human RefSeq proteins (downloaded from the ftp site linked on the home page of NCBI).

 

 

hmmsearch - search a sequence database with a profile HMM

HMMER 2.3.2 (Oct 2003)

Copyright (C) 1992-2003 HHMI/Washington University School of Medicine

Freely distributed under the GNU General Public License (GPL)

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

HMM file:                   01.hmm [vertebrate_abglobins]

Sequence database:          human.protein.faa

per-sequence score cutoff:  [none]

per-domain score cutoff:    [none]

per-sequence Eval cutoff:   <= 10       

per-domain Eval cutoff:     [none]

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

 

Query HMM:   vertebrate_abglobins

Accession:   [none]

Description: [none]

  [HMM has been calibrated; E-values are empirical estimates]

 

Scores for complete sequences (score includes all domains):

Sequence                         Description            Score    E-value  N

--------                         -----------            -----    ------- ---

gi|4504349|ref|NP_000509.1|      beta globin [Homo sa   361.9     4e-105   1

gi|4504351|ref|NP_000510.1|      delta globin [Homo s   349.1   2.7e-101   1

gi|4504347|ref|NP_000549.1|      alpha 1 globin [Homo   336.8    1.3e-97   1

gi|4504345|ref|NP_000508.1|      alpha 2 globin [Homo   336.8    1.3e-97   1

gi|6715607|ref|NP_000175.1|      G-gamma globin [Homo   331.3    6.3e-96   1

gi|28302131|ref|NP_000550.2|     A-gamma globin [Homo   328.8    3.5e-95   1

gi|4885393|ref|NP_005321.1|      epsilon globin [Homo   328.8    3.7e-95   1

gi|4885397|ref|NP_005323.1|      zeta globin [Homo sa   247.3    1.2e-70   1

gi|4885395|ref|NP_005322.1|      theta 1 globin [Homo   233.6    1.7e-66   1

gi|51510893|ref|NP_001003938.1|  hemoglobin mu chain    184.5      1e-51   1

gi|19549331|ref|NP_599030.1|     cytoglobin [Homo sap    87.2    1.9e-22   1

gi|4885477|ref|NP_005359.1|      myoglobin [Homo sapi    55.4      7e-13   1

gi|44955888|ref|NP_976312.1|     myoglobin [Homo sapi    55.4      7e-13   1

gi|44955885|ref|NP_976311.1|     myoglobin [Homo sapi    55.4      7e-13   1

gi|10864065|ref|NP_067080.1|     neuroglobin [Homo sa    -0.8     0.0004   1

gi|48675813|ref|NP_038461.2|     transportin 2 (impor   -40.5        1.5   1

 

Parsed for domains:

Sequence                         Domain  seq-f seq-t    hmm-f hmm-t      score  E-value

--------                         ------- ----- -----    ----- -----      -----  -------

gi|4504349|ref|NP_000509.1|        1/1       2   147 .]     1   148 []   361.9   4e-105

gi|4504351|ref|NP_000510.1|        1/1       2   147 .]     1   148 []   349.1 2.7e-101

gi|4504347|ref|NP_000549.1|        1/1       1   142 []     1   148 []   336.8  1.3e-97

gi|4504345|ref|NP_000508.1|        1/1       1   142 []     1   148 []   336.8  1.3e-97

gi|6715607|ref|NP_000175.1|        1/1       3   147 .]     1   148 []   331.3  6.3e-96

gi|28302131|ref|NP_000550.2|       1/1       3   147 .]     1   148 []   328.8  3.5e-95

gi|4885393|ref|NP_005321.1|        1/1       2   147 .]     1   148 []   328.8  3.7e-95

gi|4885397|ref|NP_005323.1|        1/1       1   142 []     1   148 []   247.3  1.2e-70

gi|4885395|ref|NP_005322.1|        1/1       1   142 []     1   148 []   233.6  1.7e-66

gi|51510893|ref|NP_001003938.1|    1/1       1   141 []     1   148 []   184.5    1e-51

gi|19549331|ref|NP_599030.1|       1/1      18   167 ..     1   148 []    87.2  1.9e-22

gi|4885477|ref|NP_005359.1|        1/1       1   148 [.     1   148 []    55.4    7e-13

gi|44955888|ref|NP_976312.1|       1/1       1   148 [.     1   148 []    55.4    7e-13

gi|44955885|ref|NP_976311.1|       1/1       1   148 [.     1   148 []    55.4    7e-13

gi|10864065|ref|NP_067080.1|       1/1       1   149 [.     1   148 []    -0.8   0.0004

gi|48675813|ref|NP_038461.2|       1/1     134   267 ..     1   148 []   -40.5      1.5

 

Alignments of top-scoring domains:

gi|4504349|ref|NP_000509.1|: domain 1 of 1, from 2 to 147: score 361.9, E = 4e-105

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                      v+L++eeKs+v++lWgKv  nvdEvG+EAL+RllvvYPwT+r+F+sf

  gi|4504349     2    VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESF 46  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                   GDLS++dA+mG+++VKaHGKKVl a++++l+hlD+lkgt+a+LS+LH+dK

  gi|4504349    47 GDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDK 96  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                   L+VDP+NF+LLgnvL++vLA+Hf+k+fTP vqAa++K++a+Va++LahkY

  gi|4504349    97 LHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 146 

 

                   r<-*

                   +  

  gi|4504349   147 H    147 

 

gi|4504351|ref|NP_000510.1|: domain 1 of 1, from 2 to 147: score 349.1, E = 2.7e-101

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                      v+L++eeK++v +lWgKv  nvd vG+EAL+RllvvYPwT+r+F+sf

  gi|4504351     2    VHLTPEEKTAVNALWGKV--NVDAVGGEALGRLLVVYPWTQRFFESF 46  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                   GDLSs+dA+mG+++VKaHGKKVl a++++l+hlD+lkgt+++LS+LH+dK

  gi|4504351    47 GDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDK 96  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                   L+VDP+NF+LLgnvL++vLA  f+k+fTP++qAa++K++a+Va++LahkY

  gi|4504351    97 LHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKY 146 

 

                   r<-*

                   +  

  gi|4504351   147 H    147 

 

gi|4504347|ref|NP_000549.1|: domain 1 of 1, from 1 to 142: score 336.8, E = 1.3e-97

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                      +vLs+++K+nvk++WgKvg++++E+GaEALeR+++++P+Tk+yFp+f

  gi|4504347     1    MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF 47  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                    DLS     +GsaqVK+HGKKV+dal++a++h+Dd++++l++LSdLHa+K

  gi|4504347    48 -DLS-----HGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHK 91  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                   LrVDPvNFkLL+++Llv+LA+H+p++fTPav+A+ldKflasV+tvL++kY

  gi|4504347    92 LRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 141 

 

                   r<-*

                   r  

  gi|4504347   142 R    142 

 

gi|4504345|ref|NP_000508.1|: domain 1 of 1, from 1 to 142: score 336.8, E = 1.3e-97

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                      +vLs+++K+nvk++WgKvg++++E+GaEALeR+++++P+Tk+yFp+f

  gi|4504345     1    MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF 47  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                    DLS     +GsaqVK+HGKKV+dal++a++h+Dd++++l++LSdLHa+K

  gi|4504345    48 -DLS-----HGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHK 91  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                   LrVDPvNFkLL+++Llv+LA+H+p++fTPav+A+ldKflasV+tvL++kY

  gi|4504345    92 LRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKY 141 

 

                   r<-*

                   r  

  gi|4504345   142 R    142 

 

gi|6715607|ref|NP_000175.1|: domain 1 of 1, from 3 to 147: score 331.3, E = 6.3e-96

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                       ++++e+K  ++ lWgKv  nv+  G+E+L+RllvvYPwT+r+F+sf

  gi|6715607     3    -HFTEEDKATITSLWGKV--NVEDAGGETLGRLLVVYPWTQRFFDSF 46  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                   G+LSsa+AimG+++VKaHGKKVl++l++a+khlDdlkgt+a+LS+LH+dK

  gi|6715607    47 GNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDK 96  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                   L+VDP+NFkLLgnvL+ vLA+Hf+k+fTP+vqA+++K++ +Va +L ++Y

  gi|6715607    97 LHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRY 146 

 

                   r<-*

                   +  

  gi|6715607   147 H    147 

 

gi|28302131|ref|NP_000550.2|: domain 1 of 1, from 3 to 147: score 328.8, E = 3.5e-95

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                       ++++e+K  ++ lWgKv  nv+  G+E+L+RllvvYPwT+r+F+sf

  gi|2830213     3    -HFTEEDKATITSLWGKV--NVEDAGGETLGRLLVVYPWTQRFFDSF 46  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                   G+LSsa+AimG+++VKaHGKKVl++l++a khlDdlkgt+a+LS+LH+dK

  gi|2830213    47 GNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDK 96  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                   L+VDP+NFkLLgnvL+ vLA+Hf+k+fTP+vqA+++K++ +Va +L ++Y

  gi|2830213    97 LHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRY 146 

 

                   r<-*

                   +  

  gi|2830213   147 H    147 

 

gi|4885393|ref|NP_005321.1|: domain 1 of 1, from 2 to 147: score 328.8, E = 3.7e-95

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                      v+++aeeK +v+ lW K   nv+E G+EAL+RllvvYPwT+r+F+sf

  gi|4885393     2    VHFTAEEKAAVTSLWSKM--NVEEAGGEALGRLLVVYPWTQRFFDSF 46  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                   G+LSs++Ai G+++VKaHGKKVl+++++a+k++D+lk ++akLS+LH+dK

  gi|4885393    47 GNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDK 96  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                   L+VDP+NFkLLgnv++++LA Hf+k+fTP+vqAa++K++ +Va +LahkY

  gi|4885393    97 LHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKY 146 

 

                   r<-*

                   +  

  gi|4885393   147 H    147 

 

gi|4885397|ref|NP_005323.1|: domain 1 of 1, from 1 to 142: score 247.3, E = 1.2e-70

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                      + L+  e++ +  +W+K++  +d +G E+LeRl+++ P Tk+yFp+f

  gi|4885397     1    MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHF 47  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                    DL       Gsaq +aHG KV++a ++a+k +Dd+ g+l+kLS+LHa 

  gi|4885397    48 -DLH-----PGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYI 91  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                   LrVDPvNFkLL+++Llv+LA+ fp+dfT +++Aa+dKfl +V+ vL+ kY

  gi|4885397    92 LRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKY 141 

 

                   r<-*

                   r  

  gi|4885397   142 R    142 

 

gi|4885395|ref|NP_005322.1|: domain 1 of 1, from 1 to 142: score 233.6, E = 1.7e-66

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                      + Lsae++ +v++lW K g+nv+ +  EALeR ++++P Tk+yF+++

  gi|4885395     1    MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHL 47  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                    DLS      Gs qV+aHG KV+dal+ a++ lDdl+ +l++LS LHa 

  gi|4885395    48 -DLS-----PGSSQVRAHGQKVADALSLAVERLDDLPHALSALSHLHACQ 91  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                   LrVDP  F+LLg++Llv+LA H+p+df Pa qA+ldKfl  V  +L ++Y

  gi|4885395    92 LRVDPASFQLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALVSEY 141 

 

                   r<-*

                   r  

  gi|4885395   142 R    142 

 

gi|51510893|ref|NP_001003938.1|: domain 1 of 1, from 1 to 141: score 184.5, E = 1e-51

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                        Lsa+e+  +  +W  ++g+ +  GaE L Rl++vYP Tk yFp++

  gi|5151089     1    -MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHL 46  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                      S   A     q   HG + l+a + a++h+D+l+ +l+ L dLHa 

  gi|5151089    47 ---S---ACQDATQLLSHGQRMLAAVGAAVQHVDNLRAALSPLADLHALV 90  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                   LrVDP NF LL +++ vvLAsH+  +fT ++qAa+dKfl +Va vL+ kY

  gi|5151089    91 LRVDPANFPLLIQCFHVVLASHLQDEFTVQMQAAWDKFLTGVAVVLTEKY 140 

 

                   r<-*

                   r  

  gi|5151089   141 R    141 

 

gi|19549331|ref|NP_599030.1|: domain 1 of 1, from 18 to 167: score 87.2, E = 1.9e-22

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                        Ls++e+++v+++W++  +n + vG   L R +v +P  k yF+ f

  gi|1954933    18    -ELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQF 63  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhl...DdlkgtlakLSdLH

                     +  +  +  s+q + H  +V+ al+  +++l+++D +   la   + H

  gi|1954933    64 KHMEDPLEMERSPQLRKHACRVMGALNTVVENLhdpDKVSSVLALVGKAH 113 

 

                   adKLrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLa

                   a K +V Pv Fk+L+ v+l v+A  f  df P+ q a+ K+   +    +

  gi|1954933   114 ALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVT 163 

 

                   hkYr<-*

                   + Y+  

  gi|1954933   164 AAYK    167 

 

gi|4885477|ref|NP_005359.1|: domain 1 of 1, from 1 to 148: score 55.4, E = 7e-13

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                      + Ls+ e ++v ++WgKv ++    G E L Rl+   P T   F+ f

  gi|4885477     1    MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKF 47  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                     L s d +  s   K HG  Vl+al+  lk        +  L + Ha K

  gi|4885477    48 KHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATK 97  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                    ++      + +++++ vL s +p+df  ++q a +K l    + +a+ Y

  gi|4885477    98 HKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNY 147 

 

                   r<-*

                   +  

  gi|4885477   148 K    148 

 

gi|44955888|ref|NP_976312.1|: domain 1 of 1, from 1 to 148: score 55.4, E = 7e-13

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                      + Ls+ e ++v ++WgKv ++    G E L Rl+   P T   F+ f

  gi|4495588     1    MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKF 47  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                     L s d +  s   K HG  Vl+al+  lk        +  L + Ha K

  gi|4495588    48 KHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATK 97  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                    ++      + +++++ vL s +p+df  ++q a +K l    + +a+ Y

  gi|4495588    98 HKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNY 147 

 

                   r<-*

                   +  

  gi|4495588   148 K    148 

 

gi|44955885|ref|NP_976311.1|: domain 1 of 1, from 1 to 148: score 55.4, E = 7e-13

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                      + Ls+ e ++v ++WgKv ++    G E L Rl+   P T   F+ f

  gi|4495588     1    MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKF 47  

 

                   GDLSsadAimGsaqVKaHGKKVldalaealkhlDdlkgtlakLSdLHadK

                     L s d +  s   K HG  Vl+al+  lk        +  L + Ha K

  gi|4495588    48 KHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATK 97  

 

                   LrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvLahkY

                    ++      + +++++ vL s +p+df  ++q a +K l    + +a+ Y

  gi|4495588    98 HKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNY 147 

 

                   r<-*

                   +  

  gi|4495588   148 K    148 

 

gi|10864065|ref|NP_067080.1|: domain 1 of 1, from 1 to 149: score -0.8, E = 0.0004

                   *->vvLsaeeKsnvkglWgKvggnvdEvGaEALeRllvvYPwTkryFpsf

                        +   e ++++  W  v+  + E G    +Rl++  P     F+ 

  gi|1086406     1    --MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYN 45  

 

                   G.DLSsadAimGsaqVKaHGKKVldalaealkhlDd...lkgtlakLSdL

                    +  Ss++   +s+    H +KV+  +  a+ +++d ++l + la+L  

  gi|1086406    46 CrQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDlssLEEYLASLGRK 95  

 

                   HadKLrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVatvL

                   H     V    F   g+ Ll  L   ++ +fTPa +Aa+  +  +V +++

  gi|1086406    96 H-RAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAM 144 

 

                   ahkYr<-*

                      +   

  gi|1086406   145 SRGWD    149 

 

gi|48675813|ref|NP_038461.2|: domain 1 of 1, from 134 to 267: score -40.5, E = 1.5

                   *->vvLsaeeKsnvkglWg...KvggnvdE.vGaEALeR.llvvYPwTkr

                        L  e+ +  +g++g  +K+  +  E     AL+R+l +  P   

  gi|4867581   134    -LLNSEDYNTCEGAFGalqKICEDSSElLDSDALNRpLNIMIPKFLQ 179 

 

                   yFpsfGDLSsadAimGsaqVKaHGKKVldala..ealkhlDdlkgtlakL

                   +F++    S        ++++ H    ++ ++ + a + +D++   + +L

  gi|4867581   180 FFKHC---S--------PKIRSHAIACVNQFImdRAQALMDNIDTFIEHL 218 

 

                   SdLHadKLrVDPvNFkLLgnvLlvvLAsHfpkdfTPavqAaldKflasVa

                     L  d    DP+  k    +L+  L       + P ++   + +l   

  gi|4867581   219 FALAVDD---DPEVRKNVCRALVMLLEVRIDR-LIPHMHSIIQYMLQR-- 262 

 

                   tvLahkYr<-*

                      +      

  gi|4867581   263 ---TQDHD    267 

 

 

Histogram of all scores:

score    obs    exp  (one = represents 21 sequences)

-----    ---    ---

<-185      5      -|=                                                         

 -185      0      0|                                                          

 -184      3      0|=                                                          

 -183      2      0|=                                                         

 -182      4      0|=                                                         

 -181      2      0|=                                                          

 -180      1      0|=                                                         

 -179      1      0|=                                                         

 -178      4      0|=                                                          

 -177      2      0|=                                                         

 -176      4      0|=                                                         

 -175      5      0|=                                                          

 -174      4      0|=                                                         

 -173      7      0|=                                                         

 -172     13      0|=                                                         

 -171      2      0|=                                                         

 -170      8      0|=                                                         

 -169     10      0|=                                                         

 -168      7      0|=                                                          

 -167     15      0|=                                                         

 -166      7      0|=                                                         

 -165     13      0|=                                                          

 -164     10      0|=                                                         

 -163     13      0|=                                                         

 -162     15      0|=                                                          

 -161     11      0|=                                                         

 -160     28      0|==                                                        

 -159     27      0|==                                                         

 -158     15      0|=                                                         

 -157     15      0|=                                                         

 -156     16      0|=                                                         

 -155     24      0|==                                                        

 -154     42      0|==                                                        

 -153     40      0|==                                                        

 -152     31      0|==                                                         

 -151     36      0|==                                                        

 -150     41      0|==                                                        

 -149     62      0|===                                                        

 -148     32      0|==                                                        

 -147     54      0|===                                                       

 -146     53      0|===                                                        

 -145     54      0|===                                                       

 -144     54      0|===                                                       

 -143     68      0|====                                                       

 -142     56      0|===                                                       

 -141     73      0|====                                                      

 -140     84      0|====                                                      

 -139     84      0|====                                                      

 -138     87      0|=====                                                     

 -137     87      0|=====                                                     

 -136     88      0|=====                                                     

 -135    117      0|======                                                    

 -134     87      0|=====                                                     

 -133     85      0|=====                                                      

 -132     85      0|=====                                                     

 -131     92      0|=====                                                     

 -130     98      0|=====                                                      

 -129    112      0|======                                                    

 -128    120      0|======                                                    

 -127    116      0|======                                                     

 -126    107      0|======                                                    

 -125    118      0|======                                                    

 -124    140      0|=======                                                   

 -123    141      0|=======                                                   

 -122    194      0|==========                                                

 -121    182      0|=========                                                 

 -120    198      0|==========                                                

 -119    205      0|==========                                                

 -118    219      0|===========                                               

 -117    249      0|============                                               

 -116    239      0|============                                              

 -115    287      0|==============                                            

 -114    279      0|==============                                             

 -113    308      0|===============                                           

 -112    254      0|=============                                             

 -111    320      0|================                                           

 -110    333      0|================                                          

 -109    359      0|==================                                        

 -108    400      0|====================                                      

 -107    364      0|==================                                        

 -106    415      0|====================                                      

 -105    514      0|=========================                                 

 -104    464      0|=======================                                   

 -103    489      0|========================                                  

 -102    524      0|=========================                                 

 -101    605      1|*============================                             

 -100    563      9|*==========================                               

  -99    732     38|=*=================================                       

  -98    772    118|=====*===============================                     

  -97    819    285|=============*=========================                   

  -96    891    561|==========================*================               

  -95    971    938|============================================*==            

  -94    997   1373|================================================          *

  -93   1082   1802|====================================================      *

  -92   1029   2163|=================================================         *

  -91   1091   2415|====================================================      *

  -90   1078   2542|====================================================      *

  -89   1219   2549|==========================================================*

  -88   1197   2459|========================================================= *

  -87   1149   2297|=======================================================   *

  -86    988   2091|================================================          *

  -85   1013   1864|=================================================         *

  -84   1032   1633|==================================================        *

  -83    925   1410|=============================================             *

  -82    833   1205|========================================                 *

  -81    724   1019|===================================             *         

  -80    639    856|===============================         *                 

  -79    590    715|=============================     *                        

  -78    497    594|========================    *                             

  -77    421    491|=====================  *                                  

  -76    410    405|===================*                                      

  -75    291    333|============== *                                          

  -74    280    273|============*=                                            

  -73    257    224|==========*==                                             

  -72    172    183|========*                                                 

  -71    150    149|=======*                                                  

  -70    108    122|=====*                                                    

  -69     93     99|====*                                                      

  -68     89     81|===*=                                                     

  -67     73     66|===*                                                      

  -66     53     53|==*                                                        

  -65     33     43|==*                                                       

  -64     37     35|=*                                                        

  -63     28     29|=*                                                         

  -62     17     23|=*                                                        

  -61     21     19|*                                                         

  -60      8     15|*                                                         

  -59     10     12|*                                                         

  -58      6     10|*                                                         

  -57      6      8|*                                                         

  -56      3      6|*                                                          

  -55      5      5|*                                                         

  -54      5      4|*                                                         

  -53      3      3|*                                                          

  -52      4      2|*                                                         

> -51     17      -|=                                                         

 

 

% Statistical details of theoretical EVD fit:

              mu =   -88.9473

          lambda =     0.2071

chi-sq statistic = 56172.8125

  P(chi-square)  =          0

 

Total sequences searched: 33669

 

Whole sequence top hits:

tophits_s report:

     Total hits:           88

     Satisfying E cutoff:  16

     Total memory:         23K

 

Domain top hits:

tophits_s report:

     Total hits:           88

     Satisfying E cutoff:  88

     Total memory:         73K