Web document 5.10. Results of the hmmsearch program of HMMER using a set of bacterial, fungal, and vertebrate globins as a query (HMM file 03.hmm) and searching a database of human RefSeq proteins (downloaded from the ftp site linked on the home page of NCBI).

 

 

 

hmmsearch - search a sequence database with a profile HMM

HMMER 2.3.2 (Oct 2003)

Copyright (C) 1992-2003 HHMI/Washington University School of Medicine

Freely distributed under the GNU General Public License (GPL)

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

HMM file:                   3.hmm [globins_bact]

Sequence database:          human.protein.faa

per-sequence score cutoff:  [none]

per-domain score cutoff:    [none]

per-sequence Eval cutoff:   <= 10       

per-domain Eval cutoff:     [none]

- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

 

Query HMM:   globins_bact

Accession:   [none]

Description: [none]

  [HMM has been calibrated; E-values are empirical estimates]

 

Scores for complete sequences (score includes all domains):

Sequence                         Description            Score    E-value  N

--------                         -----------            -----    ------- ---

gi|4504349|ref|NP_000509.1|      beta globin [Homo sa   170.5    1.6e-47   1

gi|44955885|ref|NP_976311.1|     myoglobin [Homo sapi   165.6    4.6e-46   1

gi|4885477|ref|NP_005359.1|      myoglobin [Homo sapi   165.6    4.6e-46   1

gi|44955888|ref|NP_976312.1|     myoglobin [Homo sapi   165.6    4.6e-46   1

gi|4504351|ref|NP_000510.1|      delta globin [Homo s   154.4    1.1e-42   1

gi|4504347|ref|NP_000549.1|      alpha 1 globin [Homo   149.9    2.6e-41   1

gi|4504345|ref|NP_000508.1|      alpha 2 globin [Homo   149.9    2.6e-41   1

gi|6715607|ref|NP_000175.1|      G-gamma globin [Homo   140.2    2.2e-38   1

gi|28302131|ref|NP_000550.2|     A-gamma globin [Homo   138.2    8.5e-38   1

gi|4885393|ref|NP_005321.1|      epsilon globin [Homo   137.9    1.1e-37   1

gi|4885397|ref|NP_005323.1|      zeta globin [Homo sa    92.3    5.5e-24   1

gi|4885395|ref|NP_005322.1|      theta 1 globin [Homo    57.5    1.6e-13   1

gi|51510893|ref|NP_001003938.1|  hemoglobin mu chain     33.2    6.5e-11   1

gi|19549331|ref|NP_599030.1|     cytoglobin [Homo sap    26.9    3.1e-10   1

gi|10864065|ref|NP_067080.1|     neuroglobin [Homo sa   -29.9    0.00038   1

gi|134133308|ref|NP_001026842.2| hypothetical protein   -60.6       0.76   1

gi|40549448|ref|NP_003362.2|     vav 2 oncogene [Homo   -68.8        5.7   1

gi|7657351|ref|NP_055335.1|      MYB binding protein    -69.4        6.7   1

gi|11225260|ref|NP_003277.1|     DNA topoisomerase I    -69.6          7   1

 

Parsed for domains:

Sequence                         Domain  seq-f seq-t    hmm-f hmm-t      score  E-value

--------                         ------- ----- -----    ----- -----      -----  -------

gi|4504349|ref|NP_000509.1|        1/1       2   147 .]     1   532 []   170.5  1.6e-47

gi|44955885|ref|NP_976311.1|       1/1       1   154 []     1   532 []   165.6  4.6e-46

gi|4885477|ref|NP_005359.1|        1/1       1   154 []     1   532 []   165.6  4.6e-46

gi|44955888|ref|NP_976312.1|       1/1       1   154 []     1   532 []   165.6  4.6e-46

gi|4504351|ref|NP_000510.1|        1/1       2   147 .]     1   532 []   154.4  1.1e-42

gi|4504347|ref|NP_000549.1|        1/1       1   142 []     1   532 []   149.9  2.6e-41

gi|4504345|ref|NP_000508.1|        1/1       1   142 []     1   532 []   149.9  2.6e-41

gi|6715607|ref|NP_000175.1|        1/1       2   147 .]     1   532 []   140.2  2.2e-38

gi|28302131|ref|NP_000550.2|       1/1       2   147 .]     1   532 []   138.2  8.5e-38

gi|4885393|ref|NP_005321.1|        1/1       2   147 .]     1   532 []   137.9  1.1e-37

gi|4885397|ref|NP_005323.1|        1/1       1   142 []     1   532 []    92.3  5.5e-24

gi|4885395|ref|NP_005322.1|        1/1       1   142 []     1   532 []    57.5  1.6e-13

gi|51510893|ref|NP_001003938.1|    1/1       1   141 []     1   532 []    33.2  6.5e-11

gi|19549331|ref|NP_599030.1|       1/1       1   181 [.     1   532 []    26.9  3.1e-10

gi|10864065|ref|NP_067080.1|       1/1      16   150 ..     1   532 []   -29.9  0.00038

gi|134133308|ref|NP_001026842.2|   1/1      59   272 ..     1   532 []   -60.6     0.76

gi|40549448|ref|NP_003362.2|       1/1     225   403 ..     1   532 []   -68.8      5.7

gi|7657351|ref|NP_055335.1|        1/1       8   177 ..     1   532 []   -69.4      6.7

gi|11225260|ref|NP_003277.1|       1/1     568   728 ..     1   532 []   -69.6        7

 

Alignments of top-scoring domains:

gi|4504349|ref|NP_000509.1|: domain 1 of 1, from 2 to 147: score 170.5, E = 1.6e-47

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      ++l+peek++                                    

  gi|4504349     2    VHLTPEEKSA------------------------------------- 11   

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                    

  gi|4504349     - -------------------------------------------------- -   

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         VtalwGKV  +++e+G           

  gi|4504349    12 ----------------------VTALWGKV--NVDEVG------------ 25  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                                ea+ RLl+++P+++++F+sf+dL++pDa++G+p+vk+

  gi|4504349    26 ------------GEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKA 63  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hg++vl +a+++ ++++dnl+gt+++ls+lh++    kL+v+Penf+llG

  gi|4504349    64 HGKKVL-GAFSDGLAHLDNLKGTFATLSELHCD----KLHVDPENFRLLG 108 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   +vl++vla+hfgke+tp+vqaA++k+++ +An+L               

  gi|4504349   109 NVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANAL---------------- 142 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|4504349     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                    

  gi|4504349     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                    

  gi|4504349     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               a+ky 

  gi|4504349   143 --------------------------------------------AHKY-- 146 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                                         

  gi|4504349   147 ----------------------------------H    147 

 

gi|44955885|ref|NP_976311.1|: domain 1 of 1, from 1 to 154: score 165.6, E = 4.6e-46

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      m+ls+ e+q+                                    

  gi|4495588     1    MGLSDGEWQL------------------------------------- 10  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                     

  gi|4495588     - -------------------------------------------------- -   

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         V+++wGKV+a+i++hG           

  gi|4495588    11 ----------------------VLNVWGKVEADIPGHG------------ 26  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                               +e++ RL++ hPe+ e+F++fk+Lks+D+mk+S+++k+

  gi|4495588    27 ------------QEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKK 64  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hga+vl+ al+ ++++++++e +++pl++ ha+    k++++++++++++

  gi|4495588    65 HGATVLT-ALGGILKKKGHHEAEIKPLAQSHAT----KHKIPVKYLEFIS 109 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   +++++vl+++++ ++++++q A++ka+e++++++               

  gi|4495588   110 ECIIQVLQSKHPGDFGADAQGAMNKALELFRKDM---------------- 143 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|4495588     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                     

  gi|4495588     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                     

  gi|4495588     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               as+y 

  gi|4495588   144 --------------------------------------------ASNY-- 147 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                          +e+G+q     +  

  gi|4495588   148 -----------------------KELGFQ-----G    154 

 

gi|4885477|ref|NP_005359.1|: domain 1 of 1, from 1 to 154: score 165.6, E = 4.6e-46

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      m+ls+ e+q+                                    

  gi|4885477     1    MGLSDGEWQL------------------------------------- 10  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                    

  gi|4885477     - -------------------------------------------------- -   

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         V+++wGKV+a+i++hG           

  gi|4885477    11 ----------------------VLNVWGKVEADIPGHG------------ 26  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                               +e++ RL++ hPe+ e+F++fk+Lks+D+mk+S+++k+

  gi|4885477    27 ------------QEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKK 64  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hga+vl+ al+ ++++++++e +++pl++ ha+    k++++++++++++

  gi|4885477    65 HGATVLT-ALGGILKKKGHHEAEIKPLAQSHAT----KHKIPVKYLEFIS 109 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   +++++vl+++++ ++++++q A++ka+e++++++               

  gi|4885477   110 ECIIQVLQSKHPGDFGADAQGAMNKALELFRKDM---------------- 143 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|4885477     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                    

  gi|4885477     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                    

  gi|4885477     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               as+y 

  gi|4885477   144 --------------------------------------------ASNY-- 147 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                          +e+G+q     +  

  gi|4885477   148 -----------------------KELGFQ-----G    154 

 

gi|44955888|ref|NP_976312.1|: domain 1 of 1, from 1 to 154: score 165.6, E = 4.6e-46

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      m+ls+ e+q+                                    

  gi|4495588     1    MGLSDGEWQL------------------------------------- 10  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                     

  gi|4495588     - -------------------------------------------------- -   

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         V+++wGKV+a+i++hG           

  gi|4495588    11 ----------------------VLNVWGKVEADIPGHG------------ 26  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                               +e++ RL++ hPe+ e+F++fk+Lks+D+mk+S+++k+

  gi|4495588    27 ------------QEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKK 64  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hga+vl+ al+ ++++++++e +++pl++ ha+    k++++++++++++

  gi|4495588    65 HGATVLT-ALGGILKKKGHHEAEIKPLAQSHAT----KHKIPVKYLEFIS 109 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   +++++vl+++++ ++++++q A++ka+e++++++               

  gi|4495588   110 ECIIQVLQSKHPGDFGADAQGAMNKALELFRKDM---------------- 143 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|4495588     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                     

  gi|4495588     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                     

  gi|4495588     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               as+y 

  gi|4495588   144 --------------------------------------------ASNY-- 147 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                          +e+G+q     +  

  gi|4495588   148 -----------------------KELGFQ-----G    154 

 

gi|4504351|ref|NP_000510.1|: domain 1 of 1, from 2 to 147: score 154.4, E = 1.1e-42

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      ++l+peek++                                    

  gi|4504351     2    VHLTPEEKTA------------------------------------- 11  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                    

  gi|4504351     - -------------------------------------------------- -   

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         V alwGKV  +++ +G           

  gi|4504351    12 ----------------------VNALWGKV--NVDAVG------------ 25  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                                ea+ RLl+++P+++++F+sf+dL+spDa++G+p+vk+

  gi|4504351    26 ------------GEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKA 63  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hg++vl +a+++ ++++dnl+gt+++ls+lh++    kL+v+Penf+llG

  gi|4504351    64 HGKKVL-GAFSDGLAHLDNLKGTFSQLSELHCD----KLHVDPENFRLLG 108 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   +vl++vla  fgke+tp  qaA++k+++ +An+L                

  gi|4504351   109 NVLVCVLARNFGKEFTPQMQAAYQKVVAGVANAL---------------- 142 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|4504351     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                    

  gi|4504351     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                    

  gi|4504351     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               a+ky 

  gi|4504351   143 --------------------------------------------AHKY-- 146 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                                         

  gi|4504351   147 ----------------------------------H    147 

 

gi|4504347|ref|NP_000549.1|: domain 1 of 1, from 1 to 142: score 149.9, E = 2.6e-41

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      m+lsp++k++                                    

  gi|4504347     1    MVLSPADKTN------------------------------------- 10  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                     

  gi|4504347     - -------------------------------------------------- -   

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         V+a+wGKV+a++ e+G           

  gi|4504347    11 ----------------------VKAAWGKVGAHAGEYG------------ 26  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                               +ea++R++ ++P ++++F++f      D+++GS+qvkg

  gi|4504347    27 ------------AEALERMFLSFPTTKTYFPHF------DLSHGSAQVKG 58  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hg++v + al +a++++d+++++L++ls+lhah    kLrv+P+nfkll+

  gi|4504347    59 HGKKVAD-ALTNAVAHVDDMPNALSALSDLHAH----KLRVDPVNFKLLS 103 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   ++ll++la+h+++e+tp+v+a+++k+++ ++++L               

  gi|4504347   104 HCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVL---------------- 137 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|4504347     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                     

  gi|4504347     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                     

  gi|4504347     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               +sky 

  gi|4504347   138 --------------------------------------------TSKY-- 141 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                               +        

  gi|4504347   142 ----------------------------R------    142 

 

gi|4504345|ref|NP_000508.1|: domain 1 of 1, from 1 to 142: score 149.9, E = 2.6e-41

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      m+lsp++k++                                    

  gi|4504345     1    MVLSPADKTN------------------------------------- 10  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                    

  gi|4504345     - -------------------------------------------------- -   

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         V+a+wGKV+a++ e+G           

  gi|4504345    11 ----------------------VKAAWGKVGAHAGEYG------------ 26  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                               +ea++R++ ++P ++++F++f      D+++GS+qvkg

  gi|4504345    27 ------------AEALERMFLSFPTTKTYFPHF------DLSHGSAQVKG 58  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hg++v + al +a++++d+++++L++ls+lhah    kLrv+P+nfkll+

  gi|4504345    59 HGKKVAD-ALTNAVAHVDDMPNALSALSDLHAH----KLRVDPVNFKLLS 103 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   ++ll++la+h+++e+tp+v+a+++k+++ ++++L                

  gi|4504345   104 HCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVL---------------- 137 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|4504345     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                    

  gi|4504345     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                    

  gi|4504345     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               +sky 

  gi|4504345   138 --------------------------------------------TSKY-- 141 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                               +        

  gi|4504345   142 ----------------------------R------    142 

 

gi|6715607|ref|NP_000175.1|: domain 1 of 1, from 2 to 147: score 140.2, E = 2.2e-38

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                       + + e+k                                      

  gi|6715607     2    GHFTEEDKAT------------------------------------- 11  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                     

  gi|6715607     - -------------------------------------------------- -   

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         +t lwGKV  ++e+ G           

  gi|6715607    12 ----------------------ITSLWGKV--NVEDAG------------ 25  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                                e++ RLl+++P+++++F+sf++L+s+ a++G+p+vk+

  gi|6715607    26 ------------GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hg++vl+ +l++a++++d+l+gt+++ls+lh++    kL+v+PenfkllG

  gi|6715607    64 HGKKVLT-SLGDAIKHLDDLKGTFAQLSELHCD----KLHVDPENFKLLG 108 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   +vl++vla hfgke+tpevqa+w+k++  +A +L               

  gi|6715607   109 NVLVTVLAIHFGKEFTPEVQASWQKMVTGVASAL---------------- 142 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|6715607     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                     

  gi|6715607     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                     

  gi|6715607     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               +s+y 

  gi|6715607   143 --------------------------------------------SSRY-- 146 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                                        

  gi|6715607   147 ----------------------------------H    147 

 

gi|28302131|ref|NP_000550.2|: domain 1 of 1, from 2 to 147: score 138.2, E = 8.5e-38

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                       + + e+k                                      

  gi|2830213     2    GHFTEEDKAT------------------------------------- 11  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                    

  gi|2830213     - -------------------------------------------------- -   

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         +t lwGKV  ++e+ G           

  gi|2830213    12 ----------------------ITSLWGKV--NVEDAG------------ 25  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                                e++ RLl+++P+++++F+sf++L+s+ a++G+p+vk+

  gi|2830213    26 ------------GETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKA 63  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hg++vl+ +l++a +++d+l+gt+++ls+lh++    kL+v+PenfkllG

  gi|2830213    64 HGKKVLT-SLGDATKHLDDLKGTFAQLSELHCD----KLHVDPENFKLLG 108 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   +vl++vla hfgke+tpevqa+w+k++ a+A +L                

  gi|2830213   109 NVLVTVLAIHFGKEFTPEVQASWQKMVTAVASAL---------------- 142 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|2830213     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                    

  gi|2830213     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                    

  gi|2830213     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               +s+y 

  gi|2830213   143 --------------------------------------------SSRY-- 146 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                                         

  gi|2830213   147 ----------------------------------H    147 

 

gi|4885393|ref|NP_005321.1|: domain 1 of 1, from 2 to 147: score 137.9, E = 1.1e-37

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      ++ ++eek +                                    

  gi|4885393     2    VHFTAEEKAA------------------------------------- 11  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                     

  gi|4885393     - -------------------------------------------------- -   

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         Vt lw K   ++ee G            

  gi|4885393    12 ----------------------VTSLWSKM--NVEEAG------------ 25  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                                ea+ RLl+++P+++++F+sf++L+sp a+ G+p+vk+

  gi|4885393    26 ------------GEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKA 63  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hg++vl+ ++++a++n+dnl+ ++++ls+lh++    kL+v+PenfkllG

  gi|4885393    64 HGKKVLT-SFGDAIKNMDNLKPAFAKLSELHCD----KLHVDPENFKLLG 108 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   +v +  la hfgke+tpevqaAw+k+++a+A +L               

  gi|4885393   109 NVMVIILATHFGKEFTPEVQAAWQKLVSAVAIAL---------------- 142 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|4885393     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                     

  gi|4885393     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                     

  gi|4885393     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               a+ky 

  gi|4885393   143 --------------------------------------------AHKY-- 146 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                                        

  gi|4885393   147 ----------------------------------H    147 

 

gi|4885397|ref|NP_005323.1|: domain 1 of 1, from 1 to 142: score 92.3, E = 5.5e-24

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      m+l+  e +i                                    

  gi|4885397     1    MSLTKTERTI------------------------------------- 10  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                    

  gi|4885397     - -------------------------------------------------- -   

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         +  +w K+   ++  G           

  gi|4885397    11 ----------------------IVSMWAKISTQADTIG------------ 26  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                                e+++RL+ +hP ++++F++f      D+ +GS+q+++

  gi|4885397    27 ------------TETLERLFLSHPQTKTYFPHF------DLHPGSAQLRA 58  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hg +v+a a ++a+++id++ g+L++ls+lha     +Lrv+P+nfkll+

  gi|4885397    59 HGSKVVA-AVGDAVKSIDDIGGALSKLSELHAY----ILRVDPVNFKLLS 103 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   ++ll++la++f++++t+e++aAw+k++++++ +L               

  gi|4885397   104 HCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVL---------------- 137 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|4885397     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                    

  gi|4885397     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                    

  gi|4885397     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               + ky 

  gi|4885397   138 --------------------------------------------TEKY-- 141 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                               +        

  gi|4885397   142 ----------------------------R------    142 

 

gi|4885395|ref|NP_005322.1|: domain 1 of 1, from 1 to 142: score 57.5, E = 1.6e-13

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      m ls+e+  +                                    

  gi|4885395     1    MALSAEDRAL------------------------------------- 10  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                     

  gi|4885395     - -------------------------------------------------- -   

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         V alw K + ++  +             

  gi|4885395    11 ----------------------VRALWKKLGSNVGVYT------------ 26  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                                ea++R + a+P+++++F +       D+++GS qv++

  gi|4885395    27 ------------TEALERTFLAFPATKTYFSHL------DLSPGSSQVRA 58  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hg++v + al+ a+  +d+l+++L++ls lha      Lrv+P+ f llG

  gi|4885395    59 HGQKVAD-ALSLAVERLDDLPHALSALSHLHAC----QLRVDPASFQLLG 103 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   ++ll++la h + ++ p++qa+++k+++ +  +L               

  gi|4885395   104 HCLLVTLARHYPGDFSPALQASLDKFLSHVISAL---------------- 137 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|4885395     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                    

  gi|4885395     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                     

  gi|4885395     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                                s+y 

  gi|4885395   138 --------------------------------------------VSEY-- 141 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                               +        

  gi|4885395   142 ----------------------------R------    142 

 

gi|51510893|ref|NP_001003938.1|: domain 1 of 1, from 1 to 141: score 33.2, E = 6.5e-11

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      m +  e++qi         +++                        

  gi|5151089     1    MLSAQERAQI---------AQV------------------------- 13  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                Wd ++  +            

  gi|5151089    14 -----------------------------WDLIAGHE------------- 21  

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                                     + +G           

  gi|5151089    22 ----------------------------------AQFG------------ 25  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                               +e + RL++++P ++ +F++        a     q+ 

  gi|5151089    26 ------------AELLLRLFTVYPSTKVYFPHL------SACQDATQLLS 57  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   Hg+r la a +aa+ ++dnl  +L+pl++lha      Lrv+P+nf+ll

  gi|5151089    58 HGQRMLA-AVGAAVQHVDNLRAALSPLADLHAL----VLRVDPANFPLLI 102 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   +++ +vla+h+ +e+t   qaAw+k++  +A +L               

  gi|5151089   103 QCFHVVLASHLQDEFTVQMQAAWDKFLTGVAVVL---------------- 136 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|5151089     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                    

  gi|5151089     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                    

  gi|5151089     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               + ky 

  gi|5151089   137 --------------------------------------------TEKY-- 140 

 

                   lGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                               +        

  gi|5151089   141 ----------------------------R------    141 

 

gi|19549331|ref|NP_599030.1|: domain 1 of 1, from 1 to 181: score 26.9, E = 3.1e-10

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      m+  p e+ i + r+++  l                          

  gi|1954933     1    MEKVPGEMEI-ERRERSEELSE------------------------- 21  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                           + r +                    

  gi|1954933    22 ------------------------AERKA--------------------- 26  

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                         V a+w    a+ e++G           

  gi|1954933    27 ----------------------VQAMWARLYANCEDVG------------ 42  

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                                + + R ++ +P ++ +F +fk++  p +m  Spq+++

  gi|1954933    43 ------------VAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRK 80  

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   H  rv+ +al +++ n+ +     + + +l ++ H++k++v+P++fk+l+

  gi|1954933    81 HACRVM-GALNTVVENLHDP-DKVSSVLALVGKAHALKHKVEPVYFKILS 128 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                    v+l+v+ae f++++ pe q Awak+  +                    

  gi|1954933   129 GVILEVVAEEFASDFPPETQRAWAKLRGLIYSHV---------------- 162 

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|1954933     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                                                    

  gi|1954933     - -------------------------------------------------- -   

 

                   eSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllms

                                                                     

  gi|1954933     - -------------------------------------------------- -   

 

                   lkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyyl

                                                               ++ y 

  gi|1954933   163 --------------------------------------------TAAY-- 166 

 

                   lGprgymtvveaylkarGvevKleefGpqqq..nCe.v<-*

                                          +e+G +qq +n  ++  

  gi|1954933   167 -----------------------KEVGWVQQvpNATtP    181 

 

gi|10864065|ref|NP_067080.1|: domain 1 of 1, from 16 to 150: score -29.9, E = 0.00038

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      ++ sp e   +                                   

  gi|1086406    16    VSRSPLEHGTV------------------------------------ 26  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                    L

  gi|1086406    27 -------------------------------------------------L 27  

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                                                    

  gi|1086406     - -------------------------------------------------- -   

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsf.kdLkspDamkGSpqvk

                                   +RL+a +P l + F     + +sp     Sp  

  gi|1086406    28 ---------------FARLFALEPDLLPLFQYNcRQFSSPEDCLSSPEFL 62  

 

                   gHgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkll

                    H ++v+ ++++aa+ n+++l + L  + + ++ kH    +vk   f+ +

  gi|1086406    63 DHIRKVM-LVIDAAVTNVEDL-SSLEEYLASLGRKHRA-VGVKLSSFSTV 109 

 

                   GkvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtg

                   G++ll  l   +g+++tp+  aAw ++y a+ +++              

  gi|1086406   110 GESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAM--------------- 144 

 

                   FrdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeit

                                                                     

  gi|1086406     - -------------------------------------------------- -   

 

                   ReYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfv

                                                                    

  gi|1086406     - -------------------------------------------------- -   

 

                   yeSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkllm

                                                                    

  gi|1086406     - -------------------------------------------------- -    

 

                   slkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispaskyy

                                                                    

  gi|1086406     - -------------------------------------------------- -   

 

                   llGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                              G +     +  

  gi|1086406   145 -------------------------SRGWD-----G    150 

 

gi|134133308|ref|NP_001026842.2|: domain 1 of 1, from 59 to 272: score -60.6, E = 0.76

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      +  +pe+ +                             p++ n+ +

  gi|1341333    59    LLRGPESQSC----------------------------PSKLNPETF 77  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                   +           aF                                   

  gi|1341333    78 V-----------AF------------------------------------ 80  

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                                                     

  gi|1341333     - -------------------------------------------------- -   

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                              C  a +RL +     +++   f       a +G+ q  g

  gi|1341333    81 -----------CIIAMDRLTK-----DTYRVRF-------ALPGNSQ-LG 106 

 

                   HgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfkllG

                   +++    + l  ++d ++ +  + +p s + a    g       +f++l

  gi|1341333   107 LRPGQH-LILRGIVDDLEIQ-RAYTPISPANAE---G-------YFEVLI 144 

 

                   kvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapWtgF

                   k+                              l+               

  gi|1341333   145 KCYQMG--------------------------LM---------------- 152  

 

                   rdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenyeitR

                                                                    

  gi|1341333     - -------------------------------------------------- -   

 

                   eYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGdfvy

                                    r+ +   V          GD+     P+Gdf+y

  gi|1341333   153 ----------------SRYVESWRV----------GDTAFWRGPFGDFFY 176 

 

                   e..S.kpvVLLagGvGlTpllSiLetlls....gRkvkflyslrtadsra

                   +++   ++ LLa+G Gl p+++iL +++ +++++  v+++   +t +s 

  gi|1341333   177 KpnQyGELLLLAAGTGLAPMVPILQSITDnendETFVTLVGCFKTFESIY 226 

 

                   fgkllmslkiky.qqlklTeF.lSh....ekeledydlidaidprkldae

                   ++ +l++     + +   T+F lS+++++e +   y+            

  gi|1341333   227 LKTFLQEQARFWnVR---TFFvLSQesssEQLPWSYQ------------- 260 

 

                   DLdlispaskyyllGprgymtvveaylkarGvevKleefGpqqqnCev<-

                        ++++ +                          ++G +       

  gi|1341333   261 -----EKTHFG--------------------------HLGQD-----L   272 

 

                   *

                   

  gi|1341333     -   -   

 

gi|40549448|ref|NP_003362.2|: domain 1 of 1, from 225 to 403: score -68.8, E = 5.7

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      ++lsp+++ ++                                   

  gi|4054944   225    LVLSPADMAAV------------------------------------ 235 

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                                                                 F  L

  gi|4054944   236 ----------------------------------------------FINL 239 

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                                                 +++i  h            

  gi|4054944   240 ------------------------------EDLIKVHH------------ 247 

 

                   ideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqvkg

                            L+   +   +++    l  vF  f                

  gi|4054944   248 -------SFLRAIDV--SVMVGGSTLAKVFLDF----------------- 271 

 

                   HgarvlahallaaadnidnlegtLgplsklh.........ahkHvgkLrv

                     +r+l+   +++ ++++++++tL +l +  ++ +++ ++++     L+v

  gi|4054944   272 -KERLLI--YGEYCSHMEHAQNTLNQLLASRedfrqkveeCT-----LKV 313 

 

                   kPenfkllGkvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadl

                   +   fkl  + ll+v               +++ ++ +  +lL      

  gi|4054944   314 QDGKFKL--QDLLVV---------------PMQRVLKY--HLL------- 337 

 

                   YkqapWtgFrdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwll

                                                                    

  gi|4054944     - -------------------------------------------------- -   

 

                   PGenyeitReYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikv

                                                                    

  gi|4054944     - -------------------------------------------------- -   

 

                   spPcGdfvyeSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtads

                                                                     

  gi|4054944     - -------------------------------------------------- -   

 

                   rafgkllm.slkiky.qqlklTeFlShekeledydlidaidprkldaeDL

                     ++ ll +s++ + +qqlk       e +    dl+  i   k+d+e L

  gi|4054944   338 --LKELLShSAERPErQQLK-------EALEAMQDLAMYINEVKRDKETL 378 

 

                   dlispaskyyllGprgymtvveaylkarGve...vKleefGpqqqnCev<

                     is  ++                     +e+ +vKleefG+      +

  gi|4054944   379 RKISEFQSS--------------------IEnlqVKLEEFGRP----KI  403 

 

                   -*

                    

  gi|4054944     -    -   

 

gi|7657351|ref|NP_055335.1|: domain 1 of 1, from 8 to 177: score -69.4, E = 6.7

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      +p sp e+++                             + + ++d+

  gi|7657351     8    QPMSPGEATQ-----------------------------SGARPADR 25  

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                    gl ++ r+  + F               Wdi  ++             

  gi|7657351    26 YGLLKHSREFLDFF---------------WDIAKPEQ------------- 47  

 

                   DWElyrgktverter..sgWlgGPVtalwGKVqayieehGHPrLRaRHmh

                               te+   +++g P         +   ++           

  gi|7657351    48 ------ETRLAATEKllEYLRGRP--------KGSEMKYA---------- 73  

 

                   frideamRDqWLfCmeaykRLlaahPeleevFnsfkdLkspDamkGSpqv

                                    +kRL++    l  v+ ++              

  gi|7657351    74 -----------------LKRLIT---GL-GVGRET--------------- 87  

 

                   kgHgarvlahallaaadnidnlegtLgplsklhahkHvgkLrvkPenfk.

                       +  +++al++++ + ++l  +L    ++++ k  + ++vk + +++

  gi|7657351    88 ---ARPCYSLALAQLLQSFEDL--PLCSILQQIQEKYDL-HQVKKAMLRp 131 

 

                   llGkvllkvlaehfgkeLtpevqaAwa..kayealAnlLIkrEadlYkqa

                    l   l  vla   +  L+ +  a++++ k+++alA+            

  gi|7657351   132 ALFANLFGVLALFQSGRLVKDQEALMKsvKLLQALAQYQ----------- 170 

 

                   pWtgFrdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGen

                                                                    

  gi|7657351     - -------------------------------------------------- -   

 

                   yeitReYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPc

                                                                     

  gi|7657351     - -------------------------------------------------- -   

 

                   GdfvyeSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafg

                                                                     

  gi|7657351     - -------------------------------------------------- -   

 

                   kllmslkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispa

                                                                    

  gi|7657351     - -------------------------------------------------- -   

 

                   skyyllGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                                +++ q     +  

  gi|7657351   171 ----------------------------NHLQEQ-----P    177  

 

gi|11225260|ref|NP_003277.1|: domain 1 of 1, from 568 to 728: score -69.6, E = 7

                   *->mplspeekqiiisrsegsallnwlkkiirkhdPvadrDpaqsnardv

                      ++++   k +                                  + 

  gi|1122526   568    LNTGILNKHL---------------------------------QDLM 581 

 

                   pgleaairalteaFYdaMdseeetlarlsWdillraaGRvgsrqKlFefL

                   +gl+      +++F                    r +            

  gi|1122526   582 EGLT------AKVF--------------------RTY------------- 592 

 

                   DWElyrgktvertersgWlgGPVtalwGKVqayieehGHPrLRaRHmhfr

                         ++ ++  + +  l++P        + +i+  +          ++

  gi|1122526   593 ------NASITLQQQLKELTAP--------DENIPAKI----------LS 618 

 

                   ideamRDqWLfC.meaykRLlaahPeleevFnsfkdLkspDamkGSpqvk

                    + a R  +++C++++      a P +   F++                

  gi|1122526   619 YNRANRAVAILCnHQR------APPKT---FEKS--------------MM 645 

 

                   gHgarvlahallaaadnidnlegtLgplsklh..ahkHvgkLrvkPenfk

                    ++ +++a  + ++ad++++l +  ++ +k++++a+             

  gi|1122526   646 NLQTKIDA-KKEQLADARRDL-KSAKADAKVMkdAK-------------- 679 

 

                   llGkvllkvlaehfgkeLtpevqaAwakayealAnlLIkrEadlYkqapW

                                     t  v ++ +ka++ l   L k+E +      

  gi|1122526   680 ------------------TKKVVESKKKAVQRLEEQLMKLEVQ------- 704 

 

                   tgFrdFkVTkkqEcSdvkSlYlkPvdGkpippkrGQYlcvrwllPGenye

                                                                    

  gi|1122526     - -------------------------------------------------- -   

 

                   itReYSiSeyPredeYRIsvrkepGGkVSnyiHntinvGDsikvspPcGd

                                                                    

  gi|1122526     - -------------------------------------------------- -   

 

                   fvyeSkpvVLLagGvGlTpllSiLetllsgRkvkflyslrtadsrafgkl

                                                                    

  gi|1122526     - -------------------------------------------------- -   

 

                   lmslkikyqqlklTeFlShekeledydlidaidprkldaeDLdlispask

                                                                 ++++

  gi|1122526   705 ----------------------------------------------ATDR 708 

 

                   yyllGprgymtvveaylkarGvevKleefGpqqqnCev<-*

                                e++ +a G + Kl ++ p+     +  

  gi|1122526   709 E------------ENKQIALGTS-KLNYLDPR-----I    728 

 

 

Histogram of all scores:

score    obs    exp  (one = represents 25 sequences)

-----    ---    ---

<-166     62      -|===                                                       

 -166      0      0|                                                          

 -165      1      0|=                                                         

 -164      3      0|=                                                          

 -163      4      0|=                                                         

 -162      2      0|=                                                         

 -161      7      0|=                                                          

 -160      5      0|=                                                         

 -159      4      0|=                                                         

 -158      9      0|=                                                          

 -157     11      0|=                                                         

 -156      7      0|=                                                         

 -155      6      0|=                                                         

 -154     13      0|=                                                         

 -153     10      0|=                                                         

 -152     14      0|=                                                         

 -151     19      0|=                                                         

 -150     18      0|=                                                         

 -149     12      0|=                                                         

 -148     19      0|=                                                          

 -147      9      0|=                                                         

 -146     28      0|==                                                        

 -145     25      0|=                                                          

 -144     24      0|=                                                         

 -143     38      0|==                                                        

 -142     31      0|==                                                         

 -141     32      0|==                                                        

 -140     40      0|==                                                        

 -139     52      0|===                                                       

 -138     46      0|==                                                        

 -137     70      0|===                                                       

 -136     73      0|===                                                       

 -135     79      0|====                                                      

 -134     91      0|====                                                      

 -133     94      0|====                                                      

 -132    107      0|=====                                                      

 -131    109      0|=====                                                     

 -130    137      0|======                                                    

 -129    158      0|=======                                                    

 -128    183      0|========                                                  

 -127    191      0|========                                                  

 -126    226      0|==========                                                 

 -125    245      0|==========                                                

 -124    251      0|===========                                               

 -123    293      0|============                                              

 -122    337      0|==============                                            

 -121    375      0|===============                                           

 -120    417      0|=================                                         

 -119    513      0|=====================                                     

 -118    581      0|========================                                  

 -117    625      0|=========================                                 

 -116    686      0|============================                              

 -115    727      0|==============================                            

 -114    888      2|*===================================                      

 -113    866     19|*==================================                       

 -112    999     89|===*====================================                  

 -111    990    279|===========*============================                  

 -110   1133    646|=========================*====================            

 -109   1161   1184|===============================================*          

 -108   1245   1806|==================================================        *

 -107   1325   2382|=====================================================     *

 -106   1351   2805|=======================================================   *

 -105   1448   3021|==========================================================*

 -104   1467   3034|==========================================================*

 -103   1368   2884|=======================================================   *

 -102   1288   2627|====================================================      *

 -101   1276   2314|====================================================      *

 -100   1224   1985|=================================================         *

  -99   1143   1668|==============================================            *

  -98   1107   1380|=============================================          *  

  -97    953   1127|=======================================      *            

  -96    831    912|==================================  *                     

  -95    746    732|=============================*                            

  -94    556    584|=======================*                                   

  -93    530    464|==================*===                                    

  -92    472    367|==============*====                                       

  -91    417    289|===========*=====                                         

  -90    302    228|=========*===                                             

  -89    266    179|=======*===                                               

  -88    217    140|=====*===                                                 

  -87    179    110|====*===                                                  

  -86    156     86|===*===                                                   

  -85    132     67|==*===                                                    

  -84     99     53|==*=                                                       

  -83    104     41|=*===                                                     

  -82     95     32|=*==                                                      

  -81     53     25|*==                                                        

  -80     30     19|*=                                                        

  -79     38     15|*=                                                        

  -78     27     12|*=                                                         

  -77     10      9|*                                                         

  -76     18      7|*                                                         

  -75      5      5|*                                                         

  -74      7      4|*                                                         

  -73      7      3|*                                                         

  -72      2      2|*                                                         

  -71      0      2|*                                                         

  -70      2      1|*                                                         

> -69     17      -|=                                                         

 

 

% Statistical details of theoretical EVD fit:

              mu =  -103.9521

          lambda =     0.2470

chi-sq statistic = 53741.1641

  P(chi-square)  =          0

 

Total sequences searched: 33669

 

Whole sequence top hits:

tophits_s report:

     Total hits:           271

     Satisfying E cutoff:  19

     Total memory:         54K

 

Domain top hits:

tophits_s report:

     Total hits:           271

     Satisfying E cutoff:  271

     Total memory:         955K