Web document 18.4. Primate lysozymes.

 

Phylogeny of the primates. A neighbor-joining tree representing primate phylogeny based on lysozyme protein sequences. These sequences were aligned using ClustalW and displayed as a neighbor-joining tree. The accession numbers are as follows: gibbon (P79180), orangutan (P79239), bonobo (AAB41214), chimpanzee (AAB41209), human (NP_000230), gorilla (P79179), Kenya baboon (P00696)(obsolete; see instead olive baboon NP_001106112), African green monkey (P00696)(see P61633 from Cercopithecus aethiops), rhesus macaque (P30201), proboscis monkey (P79811), marmoset (P79158), tamarin (P79268), and South American squirrel monkey (P79294).

 

>gibbon Hylobates_lar (common gibbon) gi|2497777|sp|P79180.1|LYSC_HYLLA Lysozyme C precursor (1,4-beta-N-acetylmuramidase C)
MKALIILGLVLLSVMVQAKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNPGDRST
DYGIFQINSRYWCNDGKTPGAVNACHLSCNALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDLR
QYIQGCGV
>orang-utan gi|2497780|sp|P79239.1|LYSC_PONPY Lysozyme C precursor (1,4-beta-N-acetylmuramidase C)
MKALIILGLVLLSVTVQSKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNPGDRST
DYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVR
QYVQGCGV
>bonobo gi|1790961|gb|AAB41214.1| lysozyme c precursor [Pan paniscus]
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRST
DYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVR
QYVQGCGV
>chimpanzee gi|1790941|gb|AAB41209.1| lysozyme c precursor [Pan troglodytes]
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRST
DYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVR
QYVQGCGV
>human gi|4557894|ref|NP_000230.1| lysozyme precursor [Homo sapiens]
MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRST
DYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVR
QYVQGCGV
>gorilla gi|2497776|sp|P79179.1|LYSC_GORGO Lysozyme C precursor (1,4-beta-N-acetylmuramidase C)
MKALIVLGLVLLSVMVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRST
DYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVR
QYVQGCGV
>baboon
>rhesus_monkey gi|156119326|ref|NP_001095203.1| lysozyme [Macaca mulatta]
MKAVIILGLVLLSVTVQGKIFERCELARTLKRLGLDGYRGISLANWVCLAKWESNYNTQATNYNPGDQST
DYGIFQINSHYWCNNGKTPGAVNACHISCNALLQDNIADAVTCAKRVVSDPQGIRAWVAWRNHCQNRDVS
QYVQGCGV
 
 
>olive_baboon gi|162951912|ref|NP_001106112.1| lysozyme [Papio anubis]
MKAVIILGLVLLSVTVQGKIFERCELARTLKRLGLDGYRGISLANWVCLAKWESDYNTQATNYNPGDQST
DYGIFQINSHYWCNNGKTPGAVNACHISCNALLQDNIADAVTCAKRVVSDPQGIRAWVAWRNHCQNRDVS
QYVQGCGV
>talapoin gi|2497778|sp|P79806.1|LYSC_MIOTA Lysozyme C precursor (1,4-beta-N-acetylmuramidase C) Miopithecus talapoin
MKAVIILGLVLLSVTVQGKIFERCELARTLKRLGLDGYRGISLANWVCLAKWESDYNTQATNYNPGDQST
DYGIFQINSHYWCNNGKTPGAVNACHISCNALLQDNIADAVTCAKRVVRDPQGIRAWVAWRNHCHNRDVS
QYVQGCGV