Web document 3.3. Multiple sequence alignment of glyceraldehyde 3 phosphate dehydrogenase.

 

This provides an example of a highly conserved protein family. To find this alignment, go to NCBI, enter gapdh, and follow the link to HomoloGene. View that entry as a multiple alignment. The accession numbers and a list of organisms are given below.

 

1:  HomoloGene:81613. Gene conserved in Eukaryota 
 Multiple Sequence Alignment 
 
NP_002037.2       1   MGKVKVGVNGFGRIGRLVTRAAFNSGKV--DIVAINDPFIDLNY   42
XP_001162057.1    1   MGKVKVGVNGFGRIGRLVTRAAFNSGKV--DIVAINDPFIDLNY   42
NP_001003142.1    1   --MVKVGVNGFGRIGRLVTRAAFNSGKV--DIVAINDPFIDLNY   40
XP_893121.1       1   --MVKVGVNGFGRIGRLVTRAAVCSGKISVEIVAINDPFIDLNY   42
XP_576394.1       1   --MVKVGVNGFGRIGRLVTRAAFSCDKV--DIVAINDPFIDLNY   40
NP_058704.1       1   --MVKVGVNGFGRIGRLVTRAAFSCDKV--DIVAINDPFIDLNY   40
XP_001070653.1    1   --MVKVGVNGFGRIGHLVTRAAFSCDKV--DIVAINDPFIDLNY   40
XP_001062726.1    1   --MVKVGVNGFGRIGRLVTRAAFSCDKV--DIVAINDPFIDLNY   40
NP_989636.1       1   --MVKVGVNGFGRIGRLVTRAAVLSGKV--QVVAINDPFIDLNY   40
NP_525091.1       1   --MSKIGINGFGRIGRLVLRAAIDKGAN---VVAVNDPFIDVNY   39
XP_318655.2       1   --MSKIGINGFGRIGRLVLRAAITKGAS---VVAINDPFIGVDY   39
NP_508535.1       1   MPKPSVGINGFGRIGRLVLRAAVEKDSVN--VVAVNDPFISIDY   42
NP_595236.1       1   MAIPKVGINGFGRIGRIVLRNAILTGKIQ--VVAVNDPFIDLDY   42
NP_011708.1       1   --MVRVAINGFGRIGRLVMRIALSRPNV--EVVALNDPFITNDY   40
XP_456022.1       1   --MVKVAINGFGRIGRLVLRIALQRKAL--EVVAVNDPFISVDY   40
NP_001060897.1    1   MGKIKIGINGFGRIGRLVARVALQSEDV--ELVAVNDPFITTDY   42
 
 
NP_002037.2      43   MVYMFQYDSTHGKFHG-TVKAENGKLVIN-----GNPITIFQER   80
XP_001162057.1   43   MVYMFQYDSTHGKFHG-TVKAENGKLVIN-----GNPITIFQER   80
NP_001003142.1   41   MVYMFQYDSTHGKFHG-TVKAENGKLVIN-----GKSISIFQER   78
XP_893121.1      43   MVYLFQSDSTHGKFNR-TVQAENGKLVIN-----GKPITIFQER   80
XP_576394.1      41   MVYMSQYGSPHGKFNS-TVKAENGKLVNN-----GKPITIFQER   78
NP_058704.1      41   MVYMFQYDSTHGKFNG-TVKAENGKLVIN-----GKPITIFQER   78
XP_001070653.1   41   MVYMFQYDSTHGKFNG-TVKAENGKLVIN-----GKPITIFQER   78
XP_001062726.1   41   MVYMFQYDSTHGKFNG-TVKAENGKLVIN-----GKPITIFQER   78
NP_989636.1      41   MVYMFKYDSTHGHFKG-TVKAENGKLVIN-----GHAITIFQER   78
NP_525091.1      40   MVYLFKFDSTHGRFKG-TVAAEGGFLVVN-----GQKITVFSER   77
XP_318655.2      40   MVYLFKYDSTHGRFKG-EVSAQDGCLVVN-----GQKIAVFQER   77
NP_508535.1      43   MVYLFQYDSTHGRFKG-TVAHEGDYLLVAKEGKSQHKIKVYNSR   85
NP_595236.1      43   MAYMFKYDSTHGRFEG-SVETKGGKLVID-----GHSIDVHNER   80
NP_011708.1      41   AAYMFKYDSTHGRYAG-EVSHDDKHIIVD-----GKKIATYQER   78
XP_456022.1      41   AAYMFKYDSTHGRYKG-EVTTSGNDLVID-----GHKIAVFQEK   78
NP_001060897.1      43   MTYMFKYDTVHGQWKHSDIKIKDSKTLLLG----EKPVTVFGIR   82
 
 
NP_002037.2      81   DP----SKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI   120
XP_001162057.1   81   DP----SKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI   120
NP_001003142.1   79   DP----ANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVI   118
XP_893121.1      81   DTPPPLANIKWGDAGADYVVESTGVFTTMEKAGAHLKGGAKRVI   124
XP_576394.1      79   DP----ANIKWGDAGAEYVMESTGIFTTMEKAGAHLKGGAKRVI   118
NP_058704.1      79   DP----ANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVI   118
XP_001070653.1   79   DP----ANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVI   118
XP_001062726.1   79   DP----ANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVI   118
NP_989636.1      79   DP----SNIKWADAGAEYVVESTGVFTTMEKAGAHLKGGAKRVI   118
NP_525091.1      78   DP----ANINWASAGAEYIVESTGVFTTIDKASTHLKGGAKKVI   117
XP_318655.2      78   DP----KAIPWGKAGAEYVVESTGVFTTTEKASAHLEGGAKKVI   117
NP_508535.1      86   DP----AEIQWGASGADYVVESTGVFTTIEKANAHLKGGAKKVI   125
NP_595236.1      81   DP----ANIKWSASGAEYVIESTGVFTTKETASAHLKGGAKRVI   120
NP_011708.1      79   DP----ANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVV   118
XP_456022.1        79   DP----ANLPWGKLGVDIVIDSTGVFKELDSAQKHLDAGAKKVV   118
NP_001060897.1     83   NP----DEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKKVV   122
 
 
NP_002037.2     121   ISAPSADAPMFVMGVNHEKYDNS-LKIISNASCTTNCLAPLAKV   163
XP_001162057.1  121   ISAPSADAPMFVMGVNHEKYDNS-LKIISNASCTTNCLAPLAKV   163
NP_001003142.1  119   ISAPSADAPMFVMGVNHEKYDNS-LKIVSNASCTTNCLAPLAKV   161
XP_893121.1     125   ISAPSADAPMFVMGVNHEKYDNS-LKIVSNASCTTNCLAPLAKV   167
XP_576394.1     119   ISAPSADAPMFVMGVNHEKYDNS-LKIVSNASCTTNCLAPLAKV   161
NP_058704.1     119   ISAPSADAPMFVMGVNHEKYDNS-LKIVSNASCTTNCLAPLAKV   161
XP_001070653.1  119   ISAPSADAPMFVMGVNHEKYDNS-LKIVSNASCTTNCLAPLGKV   161
XP_001062726.1  119   ISAPSADAPMFVMGVNHEKYDNS-LKIVSNASCTTNCLAPLAKV   161
NP_989636.1     119   ISAPSADAPMFVMGVNHEKYDKS-LKIVSNASCTTNCLAPLAKV   161
NP_525091.1     118   ISAPSADAPMFVCGVNLDAYKPD-MKVVSNASCTTNCLAPLAKV   160
XP_318655.2     118   ISAPSADAPMFVVGVNLEAYEPS-MKVVSNASCTTNCLAPLAKV   160
NP_508535.1     126   ISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKV   169
NP_595236.1     121   ISAPSKDAPMFVVGVNLEKFNPS-EKVISNASCTTNCLAPLAKV   163
NP_011708.1     119   ITAPSSTAPMFVMGVNEEKYT-SDLKIVSNASCTTNCLAPLAKV   161
XP_456022.1     119   ITAPSKTAPMFVVGVNEDKYN-GET-IVSNASCTTNCLAPIAKI   160
NP_001060897.1  123   ISAPSKDAPMFVCGVNEDKYTSD-IDIVSNASCTTNCLAPLAKV   165
 
 
NP_002037.2     164   IHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNII   207
XP_001162057.1  164   IHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNII   207
NP_001003142.1  162   IHDHFGIVEGLMTTVHAITATQKTVDGPSGKMWRDGRGAAQNII   205
XP_893121.1     168   IHDNFGIMEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNII   211
XP_576394.1     162   IHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNII   205
NP_058704.1     162   IHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNII   205
XP_001070653.1  162   IHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNII   205
XP_001062726.1  162   IHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNII   205
NP_989636.1     162   IHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNII   205
NP_525091.1     161   INDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNII   204
XP_318655.2     161   INDNFGILEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNII   204
NP_508535.1     170   INDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNII   213
NP_595236.1     164   INDTFGIEEGLMTTVHATTATQKTVDGPSKKDWRGGRGASANII   207
NP_011708.1     162   INDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNII   205
XP_456022.1     161   INDEFGIDEALMTTVHSITATQKTVDGPSHKDWRGGRTASGNII   204
NP_001060897.1  166   IHDNFGIIEGLMTTVHAITATQKTVDGPSSKDWRGGRAASFNII   209
 
 
NP_002037.2     208   PASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEK   251
XP_001162057.1  208   PASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEK   251
NP_001003142.1  206   PASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEK   249
XP_893121.1     212   PASTGAAKAVGKVIPELNGKLTGMAFRVPTRNVSVVDLTCRLEK   255
XP_576394.1     206   PASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEK   249
NP_058704.1     206   PASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEK   249
XP_001070653.1  206   PASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEK   249
XP_001062726.1  206   PASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEK   249
NP_989636.1     206   PASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEK   249
NP_525091.1     205   PASTGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGK   248
XP_318655.2     205   PAATGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLSK   248
NP_508535.1     214   PASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEK   257
NP_595236.1     208   PSSTGAAKAVGKVIPALNGKLTGMAFRVPTPDVSVVDLTVKLAK   251
NP_011708.1     206   PSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLNK   249
XP_456022.1     205   PSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLAK   248
NP_001060897.1  210   PSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEK   253
 
 
NP_002037.2     252   PAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTF   295
XP_001162057.1  252   PAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTF   295
NP_001003142.1  250   AAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDTHSSTF   293
XP_893121.1     256   HAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNNNSHSSTF   299
XP_576394.1     250   PAKYDDIKKVVKQAAEGPLKGILGYTEDQVVSCDFNSNSHSSTF   293
NP_058704.1     250   PAKYDDIKKVVKQAAEGPLKGILGYTEDQVVSCDFNSNSHSSTF   293
XP_001070653.1  250   PAKYDDIKKVVKQVAEGPLKGILGYTEDQVVSCDFNSNSHSSTF   293
XP_001062726.1  250   PAKYDDIKKVVKQAAEGPLKGILGYTEDQVVSCDFNSNSHSSTF   293
NP_989636.1     250   PAKYDDIKRVVKAAADGPLKGILGYTEDQVVSCDFNGDSHSSTF   293
NP_525091.1     249   GASYDEIKAKVQEAANGPLKGILGYTDEEVVSTDFLSDTHSSVF   292
XP_318655.2     249   PATYDQIKQKVKEAANGPMKGILDYTEEEVVSTDFVGDCHSSIF   292
NP_508535.1     258   PASLDDIKKVIKAAADGPMKGILAYTEDQVVSTDFVSDTNSSIF   301
NP_595236.1     252   PTNYEDIKAAIKAASEGPMKGVLGYTEDSVVSTDFCGDNHSSIF   295
NP_011708.1     250   ETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSHSSIF   293
XP_456022.1     249   EATYDEIKAAVKKASQGKLKNVVGYTEDSVVSSDFLGDTHSTIF   292
NP_001060897.1  254   AASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIF   297
 
 
NP_002037.2     296   DAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE   335
XP_001162057.1  296   DAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE   335
NP_001003142.1  294   DAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMVYMASKE   333
XP_893121.1     300   DAGAGIALNDNFVKLISWYDNEYGYSNRMVDLMAYMASKE   339
XP_576394.1     294   DAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE   333
NP_058704.1     294   DAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE   333
XP_001070653.1  294   DAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE   333
XP_001062726.1  294   DAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE   333
NP_989636.1     294   DAGAGIALNDHFVKLVSWYDNEFGYSNRVVDLMVHMASKE   333
NP_525091.1     293   DAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD   332
XP_318655.2     293   DAKAGIQLSDTFVKLISWYDNEYGYSNRVVDLIKYMQTKD   332
NP_508535.1     302   DAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYIATKA   341
NP_595236.1     296   DASAGIQLSPQFVKLVSWYDNEWGYSHRVVDLVAYTASKD   335
NP_011708.1     294   DASAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHVAKA-   332
XP_456022.1     293   DASAGIQLSPKFVKVVAWYDNEYGYSERVVDLVEHVA---   329
NP_001060897.1  298   DAKAGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMAKTQ   337
 
 
Protein Acc. Gene Organism
 
NP_002037.2 GAPDH H.sapiens
XP_001162057.1 GAPD P.troglodytes
NP_001003142.1 GAPDH C.lupus
XP_893121.1 EG622339 M.musculus
XP_576394.1 RGD1565368_predicted R.norvegicus
NP_058704.1 Gapdh R.norvegicus
XP_001070653.1 LOC689689 R.norvegicus
XP_001062726.1 LOC685186 R.norvegicus
NP_989636.1 GAPDH G.gallus
NP_525091.1 Gapdh2 D.melanogaster
XP_318655.2 AgaP_ENSANGG00000007871 A.gambiae
NP_508535.1 gpd-2 C.elegans
NP_595236.1 SPBC354.12 S.pombe
NP_011708.1 TDH3 S.cerevisiae
XP_456022.1 G3P_KLULA K.lactis
NP_001060897.1 Os08g0126300 O.sativa