Web Document 3.4. (See the textbook Fig. 3.8.) Multiple sequence alignment of kappa caseins, representing a protein family that is relatively poorly conserved. The sequences were aligned with MUSCLE 3.6 (see Chapter 6) and were human (NP_005203), equine (Equus caballus; NP_001075353), pig (Sus scrofa NP_001004026), ovine (Ovis aries NP_001009378), rabbit (Oryctolagus cuniculus P33618), bovine (Bos taurus NP_776719) and mouse (Mus musculus NP_031812).

 

>human gi|4885161|ref|NP_005203.1| casein kappa [Homo sapiens]
MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYGTNLYQRRPAIA
INNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRLPNLHPSFIAIPPKKIQDKIIIPTINTIATV
EPTPAPATEPTVDSVVTPEAFSESIITSTPETTTVAVTPPTA
>horse gi|126352442|ref|NP_001075353.1| kappa casein [Equus caballus]
MKSFFLVVNILALTLPFLGAEVQNQEQPTCHKNDERFFDLKTVKYIPIYYVLNSSPRYEPIYYQHRLALL
INNQHMPYQYYARPAAVRPHVQIPQWQVLPNIYPSTVVRHPCPHPSFIAIPPKKLQEITVIPKINTIATV
EPTPIPTPEPTVNNAVIPDASSEFIIASTPETTTVPVTSPVVQKL
>pig gi|55742766|ref|NP_001004026.1| casein kappa [Sus scrofa]
MMKSSFLIVPILALTLPFLGAEEQNQEKLTRCESDKRLFNEEKVKYIPIYYMLNRFPSYGFFYQHRSAVS
PNRQFIPYPYYARPVVAGPHAQKPQWQDQPNVYPPTVARRPRPHASFIAIPPKKNQDKTAIPAINSIATV
EPTIVPATEPIVNAEPIVNAVVTPEASSEFLITSAPETTTVQVTSPVV
>sheep gi|57164381|ref|NP_001009378.1| casein kappa [Ovis aries]
MMKSFFLVVTILALTLPFLGAQEQNQEQRICCEKDERFFDDKIAKYIPIQYVLSRYPSYGLNYYQQRPVA
LINNQFLPYPYYAKPVAVRSPAQTLQWQVLPNAVPAKSCQDQPTAMARHPHPHLSFMAIPPKKDQDKTEI
PAINTIASAEPTVHSTPTTEAVVNAVDNPEASSESIASAPETNTAQVTSTEV
>rabbit gi|461695|sp|P33618|CASK_RABIT Kappa-casein precursor
MMKHFLLVVNILAVTLPFLAADIQNQEQTTCRENEERLFHQVTAPYIPVHYVMNRYPQYEPSYYLRRQAV
PTLNPFMLNPYYVKPIVFKPNVQVPHWQILPNIHQPKVGRHSHPFFMAILPNKMQDKAVTPTTNTIAAVE
PTPIPTTEPVVSTEVIAEASPELIISPETTTEATAASAAA
>cattle gi|27881412|ref|NP_776719.1| casein kappa [Bos taurus]
MMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYGLNYYQQKPVA
LINNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKSCQAQPTTMARHPHPHLSFMAIPPKKNQDKTEI
PTINTIASGEPTSTPTTEAVESTVATLEDSPEVIESPPEINTVQVTSTAV
>mouse gi|75677412|ref|NP_031812.2| casein kappa [Mus musculus]
MMRNFIVVVNILALTLPFLAAEIQNPDSNCRGEKNDIVYDEQRVLYTPVRSVLNFNQYEPNYYHYRPSLP
ATASPYMYYPLVVRLLLLRSPAPISKWQSMPNFPQSAGVPYAIPNPSFLAMPTNENQDNTAIPTIDPITP
IVSTPVPTMESIVNTVANPEASTVSINTPETTTVPVSSTAA

 

MUSCLE (3.6) multiple sequence alignment
 
 
mouse           MMRNFIVVVNILALTLPFLAAEIQNPDSNCRGEKNDIVYDEQRVLYTPVRSVLN-FNQYE
rabbit          MMKHFLLVVNILAVTLPFLAADIQNQEQTTCRENEERLFHQVTAPYIPVHYVMNRYPQYE
sheep           MMKSFFLVVTILALTLPFLGAQEQNQEQRICCEKDERFFDDKIAKYIPIQYVLSRYPSYG
cattle          MMKSFFLVVTILALTLPFLGAQEQNQEQPIRCEKDERFFSDKIAKYIPIQYVLSRYPSYG
pig             MMKSSFLIVPILALTLPFLGAEEQNQEKLTRCESDKRLFNEEKVKYIPIYYMLNRFPSYG
human           -MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYYVPNSYPYYG
horse           -MKSFFLVVNILALTLPFLGAEVQNQEQPTCHKNDERFFDLKTVKYIPIYYVLNSSPRYE
                 *.  :::*  **:*****..: ** ..    :.:.  :    . * *:  : .    * 
 
mouse           PNYYHYRPSLPATASPYMYYPLVVRLLLLRSPAPISKWQSMPNF--------PQSAGVPY
rabbit          PSYYLRRQAVP-TLNPFMLNPYYVKPIVFKPNVQVPHWQILPNI--------HQPKVGRH
sheep           LNYYQQRPVAL-INNQFLPYPYYAKPVAVRSPAQTLQWQVLPNAVPAKSCQDQPTAMARH
cattle          LNYYQQKPVAL-INNQFLPYPYYAKPAAVRSPAQILQWQVLSNTVPAKSCQAQPTTMARH
pig             F-FYQHRSAVS-PNRQFIPYPYYARPVVAGPHAQKPQWQDQPNV--------YPPTVARR
human           TNLYQRRPAIA-INNPYVPRTYYANPAVVRPHAQIPQRQYLPNS--------HPPTVVRL
horse           PIYYQHRLALL-INNQHMPYQYYARPAAVRPHVQIPQWQVLPNI--------YPSTVVRH
                   *  .         .:     ..     . .   :.*  .*           .     
 
mouse           AIPNPSFLAMPTNENQDNTAIPTIDPITPIVST--PVPTM------ESIVNTVANPEAST
rabbit          S--HPFFMAILPNKMQDKAVTPTTNTIAAVEPT--PIPTT------EPVVSTEVIAEASP
sheep           PHPHLSFMAIPPKKDQDKTEIPAINTIASAEPTVHSTPTT------EAVVNAVDNPEASS
cattle          PHPHLSFMAIPPKKNQDKTEIPTINTIASGEPT--STPTT------EAVESTVATLEDSP
pig             PRPHASFIAIPPKKNQDKTAIPAINSIATVEPT--IVPATEPIVNAEPIVNAVVTPEASS
human           PNLHPSFIAIPPKKIQDKIIIPTINTIATVEPT--PAPAT------EPTVDSVVTPEAFS
horse           PCPHPSFIAIPPKKLQEITVIPKINTIATVEPT--PIPTP------EPTVNNAVIPDASS
                .  :  *:*: .:: *:    *  :.*:.  .*    *:       *.  .     :  .
 
mouse           VSINT--PETTTVPVSSTAA---
rabbit          ELIIS--PETTTEATAASAAA--
sheep           ESIASA-PETNTAQVTSTEV---
cattle          EVIESP-PEINTVQVTSTAV---
pig             EFLITSAPETTTVQVTSPVV---
human           ESIITSTPETTTVAVTPPTA---
horse           EFIIASTPETTTVPVTSPVVQKL
                  : :  ** .*  .:.. .