Web document 7.1. 13 globin protein sequences.

 

These sequences were obtained from searches of NCBI Entrez Protein following the information provided in Dayhoff et al. (1972), p.20.

 

>myoglobin_kangaroo P02194 Macropus rufus (red kangaroo)
MGLSDGEWQLVLNIWGKVETDEGGHGKDVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGITVL
TALGNILKKKGHHEAELKPLAQSHATKHKIPVQFLEFISDAIIQVIQSKHAGNFGADAQAAMKKALELFR
HDMAAKYKEFGFQG
>myoglobin_harbor_porpoise P68278 Phocoena phocoena 
MGLSEGEWQLVLNVWGKVEADLAGHGQDVLIRLFKGHPETLEKFDKFKHLKTEAEMKASEDLKKHGNTVL
TALGGILKKKGHHDAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPAEFGADAQGAMNKALELFR
KDIATKYKELGFHG
>myoglobin_gray_seal P68081 Halichoerus grypus
MGLSDGEWHLVLNVWGKVETDLAGHGQEVLIRLFKSHPETLEKFDKFKHLKSEDDMRRSEDLRKHGNTVL
TALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSKHPAEFGADAQAAMKKALELFR
NDIAAKYKELGFHG
>alpha_globin_horse P01958 Equus caballus
MVLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLA
VGHLDDLPGALSNLSDLHAHKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSK
YR
>alpha_globin_kangaroo P01975 Macropus giganteus (eastern gray kangaroo)
VLSAADKGHVKAIWGKVGGHAGEYAAEGLERTFHSFPTTKTYFPHFDLSHGSAQIQAHGKKIADALGQAV
EHIDDLPGTLSKLSDLHAHKLRVDPVNFKLLSHCLLVTFAAHLGDAFTPEVHASLDKFLAAVSTVLTSKY
R
>alpha_globin_dog P60529 Canis lupus familiaris (dog)
VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGKKVADALTTAV
AHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPAVHASLDKFFAAVSTVLTSKY
R
>beta_globin_dog XP_537902 Canis lupus familiaris (dog)
MVHLTAEEKSLVSGLWGKVNVDEVGGEALGRLLIVYPWTQRFFDSFGDLSTPDAVMSNAKVKAHGKKVLN
SFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVAN
ALAHKYH
>beta_globin_rabbit NP_001075729 Oryctolagus cuniculus (rabbit)
MVHLSSEEKSAVTALWGKVNVEEVGGEALGRLLVVYPWTQRFFESFGDLSSANAVMNNPKVKAHGKKVLA
AFSEGLSHLDNLKGTFAKLSELHCDKLHVDPENFRLLGNVLVIVLSHHFGKEFTPQVQAAYQKVVAGVAN
ALAHKYH
>beta_globin_kangaroo P02106 Macropus giganteus (eastern gray kangaroo)
VHLTAEEKNAITSLWGKVAIEQTGGEALGRLLIVYPWTSRFFDHFGDLSNAKAVMANPKVLAHGAKVLVA
FGDAIKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNIIVICLAEHFGKEFTIDTQVAWQKLVAGVANA
LAHKYH
>globin_lamprey 690951A Lampetra fluviatilis (European river lamprey)
PIVDSGSPAVLSAAEKTKIRSAWAPVYSNYETSGVDILVKFFTSTPAAQEFFPKFKGMTSADELKKSADV
RWHAERIINAVNDAVASMDDTEKMSMKDLSGKHAKSFQVDPQYFKVLAVIADTVAAGDAGFEKLSMCIIL
MLRSAY
>globin_sealamprey P02208 Petromyzon marinus (sea lamprey)
MPIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGLTTADQLKKSAD
VRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKSFQVDPQYFKVLAAVIADTVAAGDAGFEKLMS
MICILLRSAY
>globin_insect P02229 Chironomus thummi thummi (midge)
MKFLILALCFAAASALSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQFAGKDLESIKGTAPF
EIHANRIVGFFSKIIGELPNIEADVNTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATL
DTFFGMIFSKM
>globin_soybean 711674A Glycine max (soybean)
VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLANPTDGVNPKLTGHAEKLFALVR
DSAGQLKASGTVVADAALGSVHAQKAVTNPEFVVKEALLKTIKAAVGDKWSDELSRAWEVAYDELAAAIK
AK