Web document 7.6. Eleven randomly selected protein sequences used for phylogenetic analysis.

 

HomoloGene at NCBI was searched with the word “protein” and the first entry from the first entries were selected, aligned by ClustalW in MEGA4, and used to create a neighbor-joining tree.

 

>gi|62079177|ref|NP_001014243.1| hypothetical protein LOC363337 [Rattus norvegicus]
MWNAGRETSSPGTELSENQAKKEKERLIKELQLITEERNDLRDRLRFLTERSMKNRSHFRPNPYYEDLER
MEEAVMSILHNLEMENTEVHENNHKLKKEITFSR
>gi|57913281|ref|XP_554483.1| ENSANGP00000028549 [Anopheles gambiae str. PEST]
QSWTDQQLKTAILAVQSGSSQQSVAREFGIPRTTLDRYLKKDKNTKSSLGSHSPVLTNAQELLLEKHIIT
MAKQCYGLTPREMRSVAFEVAESNNIAHPFNKSLRLAGVDWLKGFMDRHPNITVRTPENTSLARARGFNK
ESVKEFFDVLETVLSEQDFPPHKIWNMDETGFSTVQTKPNKVLAKRGEHQVGVISSSERGTNTTVIMAMS
ASGDYLPPMFIYARQRLNEGLKTGAPEGSKFGCSKNGWSTMETCMEWFDHFLAFTRPTVDSPILLVMDGH
SSHTKNWPLLEKAKNSFVRIITIPPHTSHKLQPLDVTFMGPLKTYYSSAIG
>gi|39940830|ref|XP_359952.1| hypothetical protein MG11023.4 [Magnaporthe grisea 70-15]
MAPIEAETGARPRDPLSLPLPEEDLETGQQQKALEMVRQARQAQELARNNGLGAQIEQQRQANKKRRPVD
FTVGDAVYVSKKGFSTEAPTTKLDSQNAGPWTILEEKGHSFILDTPAWYKGSKLFHASRLRKAATDPLPQ
QYQKPEPPVEINGEPEWEVEQVLASRLFGRKKTLQYQGYLLLDTFHKEYPDAAGPPVNLQQWIRSAAEDV
FAEDGPEDNVAEHDAKKTRERRKAPRRHT
>gi|109513077|ref|XP_001054232.1| PREDICTED: hypothetical protein [Rattus norvegicus]
MAPNSLDVDLWHWNRVPEGKSGQSDKCPKDISTDMFSRLCRCFGRVDVVREESRVKQTKPKEACRQTSSP
ENILNKVQANEEEERLNRELELTTKERNELTDRLLYVTGGSMSKSPYFRPNPFYENLKIKEKEVMSLLHN
LDKKNIEHREKFQELKKEINFYR
>gi|39939770|ref|XP_359422.1| hypothetical protein MG10987.4 [Magnaporthe grisea 70-15]
MASPEVSNRRARPQSTPQALPQGQAESGHVSLDTRTANAPQPAGRGRYSSLPALAIKTLQQELENVETVG
SWLEEVFAAKLESLQAPEDAALRRIVLELDDVISGWFLSRTLPEKERSRSPSRSPTSSSERRSILITRTG
TASSASKGRGTPTNKSVTWAERAATPPAAAPTQILTPATRSYPIRTTPGNAPDSSATPSQSGRDRSQAPK
RLTEQPSNRILIRVNDKLRMVTREPYAVTTKLAELVSVPHSEIPNAKRTPTGWGVTVASEETRQKLLNPS
AVKAIMDALDAREVTVPTTWHTYAVSGVPRTLNCLDGRKDVHEVIQEEITVAAGQQPVNWHISKHGYDPH
TAEGTWIVSFLQPVKPFQLFGVDSKPCAEARCGICGEAKHATEEEPCKAAPKCVNCHGHFPSGHENCPAR
PLVVNGKFERPSQRKLKGIRRIGRANRAAIINDRAETARREPAPAIPVLNTTSQHSQTSSSRSSISNKRA
RPCEAAGADIRNFLQAEQERVHDEIVWAAEMEEDAAAAEICPADGIDLEATRRLI
>gi|71043740|ref|NP_001020926.1| hypothetical protein LOC367620 [Rattus norvegicus]
MFRQLLRLFRKESGDQGETTPRQKEDDLLSSKTGRRKSFWGRLGFGRKTSSQNVISEQEKCRKELEELKL
EIQKCKFERDELYQILDLYIYDDWDLRLDVELPILQSEHERRMMSMQMMTNSISDAMERYKELIQANSSY
RIRHSQLLREQAQLKNKIQILLNEKREQLVEQTELPASYVEAKRLCEEAGMNICVPSAKQQQV
>gi|7839187|ref|NP_058171.1| Retrotransposon TYA Gag and TYB Pol genes; transcribed/translated as one unit; polyprotein is processed to make a nucleocapsid-like protein (Gag), reverse transcriptase (RT), protease (PR), and integrase (IN); similar to retroviral genes [Saccharomyces cerevisiae]
MESQQLSQHSHISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHA
SPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPMYFPPGPQSQFPQYPSSVGTP
LSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPNDFPNWVKTYIKFLQNSNLGGIIPTVNGKPVR
QITDDELTFLYNTFQIFAPSQFLPTWVKDILSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGS
TPADAFETKVTNIIDRLNNNGIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQ
QGSRNSKPNYRRNLSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKS
TTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTLIRSAHHIHSASSNPDINVVDAQ
KRNIPINAIGDLQFHFQDNTKTSIKVLHTPNIAYDLLSLNELAAVDITACFTKNVLERSDGTVLAPIVQY
GDFYWVSKRYLLPSNISVPTINNVHTSESTRKYPYPFIHRMLAHANAQTIRYSLKNNTITYFNESDVDWS
SAIDYQCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTKFRWV
YPLHDRREDSILDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGITPCYTTTADSRAHGV
AERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLASPKSKKSASQHAGLAGLDISTLLPFGQPV
IVNDHNPNSKIHPRGIPGYALHPSRNSYGYIIYLPSLKKTVDTTNYVILQGKESRLDQFNYDALTFDEDL
NRLTASYHSFIASNEIQESNDLNIESDHDFQSDIELHPEQPRNVLSKAVSPTDSTPPSTHTEDSKPISEI
NLRAPREVDPNISESNILPSKKRSSTPQISNIESTGSGGMHKLNVPLLAPMSQSNTHESSHASKSKDFRH
SDSYSNNETNHTNVPISSTGGTNNKTVPQISDQETEKRIIHRSPSIDASPPENNSSHNIVPIKTPTTVSE
QNTEESIIADLPLPDPPPEPPTELSDSFKELPPINSRQTNSSLGGIGDSNAYTTINSKKRSLEDNETEIK
VSRDTWNTKNMRSLEPPRSKKRIHLIAAAKAVKSIKPIRTTLRYDEAITYNKDIKEKEKYIEAYHKEVNQ
LLKMNTWDTDKYYDRKEIDPKRVINSMFIFNKKRDGTHKARFVARGDIQHPDTYDTGMQSNTVHHYALMT
SLSLALDNNYYITQLDISSAYLYADIKEELYIRPPPHLGMNDKLIRLKKSHYGLKQSGANWYETIKSYLI
KQCGMEEVRGWSCVFKNSQVTICLFVDDMILFSKDLNANKKIITTLKKQYDTKIINLGESDNEIQYDILG
LEIKYQRGKYMKLGMENSLTEKIPKLNVPLNPKGRKLSAPGQPGLYIDQDELEIDEDEYKEKVHEMQKLI
GLASYVGYKFRFDLLYYINTLAQHILFPSRQVLDMTYELIQFMWDTRDKQLIWHKNKPTEPDNKLVAISD
ASYGNQPYYKSQIGNIFLLNGKVIGGKSTKASLTCTSTTEAEIHAVSEAIPLLNNLSHLVQELNKKPIIK
GLLTDSRSTISIIKSTNEEKFRNRFFGTKAMRLRDEVSGNNLYVYYIETKKNIADVMTKPLPIKTFKLLT
NKWIH
>gi|62078715|ref|NP_001014015.1| hypothetical protein LOC305806 [Rattus norvegicus]
MFLPGKLQPVSVAQWFVNCKFPSRKVVVFIKPTCPYCRKTQEILSQLPFKPGLLESVNITVTNITNAIQD
YLQQLTGWRTVPQVFIGKERLHRQTQ
>gi|6319629|ref|NP_009711.1| Diaminohydroxyphoshoribosylaminopyrimidine deaminase; catalyzes the second step of the riboflavin biosynthesis pathway [Saccharomyces cerevisiae]
MSLTPLCEDLPQFLQNYLPNAGQTENTIVPFVTLTYAQSLDARVSRGPGVRTTISHPETKTMTHYLRHHH
DGILVGSGTVLADNPGLNCKWGPDPAANSPRPIIIDTKQKWRFDGSKMQELFIKRQGKPPIVVVTSEPII
KEQHVDYAICPINDTTKLVDWKKLFEILKEEFNIRSVMVEGGANVINQLLLRSDIVNSLIITIGSTFLGS
SGTEVSPPQTVNLKDMSWWKGITDVVLCARLADD
>gi|39939998|ref|XP_359536.1| hypothetical protein ( (AB074754) putative transposase [Magnaporthe grisea]) [Magnaporthe grisea 70-15]
MTSPESPAILGARMYAQYVETHRSRADTAREGRSKPESLRSFCKRNGYPYSSTQRHARNLLINGIPKISI
KRSGRPSLLTDAEDQALVAYIMQLDKLGAYPDSQHVISAANLMRQSRIPPCGPIQMNWYGRWRKKHPELR
LTKQQPVEITRLSWEQQIDLVEAWYRRTAAHAVELGITASAAWNADECGTRIGVRDGRIPVLVVTKKRHE
KPRTADPANRESCTLIGGGNAVGQSLPPFCIFTKWPTSDWLDLDLPEGIVFTRSETGFSNGDIQLTWIQH
FNRYSWPEVAAVQSIGSPTLKEWFGHDFDVRFDFVNRTAAKIDPNSQRAKTRIWRWLFLDGFTGHFGMEI
LDYCLRFDIEIVILPPHSTHYMQPMDVSVFTHLKNELQAVLHEHINTGIPVFTRSDFVAAIRRCWQTAFT
TGHVISGFQDTGLFPVDGTKVLAKLRGHATAANTPRYPDSLPTAERFSRAKYAASRMAAKAHHFSSDTVD
AISDLQAVANEAIILQQRVAQEQTNKQKRLQRASRYKVKMTLKSKDKQFQTANTLEDMRVAHEAKQALIE
ETALYQQEKFVRDAWYRDKNQAIQRWRETEGMPNGIKIQQKRYLEDLGFTPENVPAVRERPGKRKKTDSQ
PSQSWFVDKGPISAGNTSTQINITVDTDSACSISICVSRSSQSASPPAPNRPSKPFPRYIPLATPSPRQL
QDTRPLEDRSSPPIPGGRKDELEVPGSPCDRLSDRKRAIEPKLQK
>gi|118084797|ref|XP_001231224.1| PREDICTED: hypothetical protein [Gallus gallus]
MGAESVVVNGPEISKLASITTHPALRQRLYAAVQHNEENHSLIAWLMAACRATWANKTDIPLNTGLWSSM
EDLQNYIRELGMKEAIYEDNFESPDMIKFSAGMRDLILQQAPPHQYGTLVSILNPLVASEAIIQQAAQLV
ADLGETERLRARRNVRMVVEKSDIHPPPRPRRPALNVIQSGPIRVSRKQMFSDLIRAGVQFQKIDGQPNQ
VLLQLWKQLPNSQRFQSSPKREGVRLIERIPQNTWNLEDFIVPSKKRKPPQVARAATVEPSEEKDLGIAE
LMA